Now Offering Over 102,157 Antibodies & 44,722 Antigens!

BACE1 antibody - N-terminal region (ARP46851_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP46851_P050-FITC Conjugated

ARP46851_P050-HRP Conjugated

ARP46851_P050-Biotin Conjugated

Gene Symbol:
BACE1
NCBI Gene Id:
23621
Official Gene Full Name:
Beta-site APP-cleaving enzyme 1
Protein Name:
Beta-secretase 1
Swissprot Id:
P56817
Protein Accession #:
NP_036236
Nucleotide Accession #:
NM_012104
Alias Symbols:
ASP2, BACE, FLJ90568, HSPC104, KIAA1149
Replacement Item:
This antibody may replace item sc-10053 from Santa Cruz Biotechnology.
Description of Target:
Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein (APP) by two proteases, one of which is the protein. BACE1, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease that is found mainly in the Golgi.Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein (APP) by two proteases, one of which is the protein encoded by this gene. The encoded protein, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease that is found mainly in the Golgi. Four transcript variants encoding different isoforms have been described for this gene.
Protein Size (# AA):
501
Molecular Weight:
51kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB, IF
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human BACE1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 91%
Complete computational species homology data:
ARP46851_P050
Peptide Sequence:
Synthetic peptide located within the following region: GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
COPS5; BRI3; RANBP9; APP; PCSK9; GGA1; GGA3; GGA2; UBC; FBXO2; CMPK1; ITM2C; KHSRP; PLSCR1; NCSTN; PDIA3; CSNK1D; SELPLG; ATP1B1; PSAP; FURIN; MMP2; LRP1; PSEN1;
Blocking Peptide:
Catalog # AAP46851 (Previous Catalog # AAPP27647)
Datasheets/Manuals:
Printable datasheet for ARP46851_P050
Additional Information:
IHC Information: Testis
IHC Information: Adrenal
Target Reference:
Shimizu,H., (2008) Mol. Cell. Biol. 28 (11), 3663-3671

Tell us what you think about this item!

Write A Review
    Please, wait...