Now Offering Over 102,157 Antibodies & 44,722 Antigens!

AZIN2 Antibody - middle region (ARP52476_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP52476_P050-FITC Conjugated

ARP52476_P050-HRP Conjugated

ARP52476_P050-Biotin Conjugated

Gene Symbol:
AZIN2
NCBI Gene Id:
113451
Official Gene Full Name:
antizyme inhibitor 2
Protein Name:
antizyme inhibitor 2
Swissprot Id:
Q96A70
Protein Accession #:
NP_443724
Nucleotide Accession #:
NM_052998
Alias Symbols:
ADC, AZI2, ODCp, AZIB1, ODC-p, ODC1L
Replacement Item:
This antibody may replace item sc-104492 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene belongs to the antizyme inhibitor family, which plays a role in cell growth and proliferation by maintaining polyamine homeostasis within the cell. Antizyme inhibitors are homologs of ornithine decarboxylase (ODC, the key enzyme in polyamine biosynthesis) that have lost the ability to decarboxylase ornithine; however, retain the ability to bind to antizymes. Antizymes negatively regulate intracellular polyamine levels by binding to ODC and targeting it for degradation, as well as by inhibiting polyamine uptake. Antizyme inhibitors function as positive regulators of polyamine levels by sequestering antizymes and neutralizing their effect. This gene encodes antizyme inhibitor 2, the second member of this gene family. Like antizyme inhibitor 1, antizyme inhibitor 2 interacts with all 3 antizymes and stimulates ODC activity and polyamine uptake. However, unlike antizyme inhibitor 1, which is ubiquitously expressed and localized in the nucleus and cytoplasm, antizyme inhibitor 2 is predominantly expressed in the brain and testis and localized in the endoplasmic reticulum-golgi intermediate compartment. Recent studies indicate that antizyme inhibitor 2 is also expressed in specific cell types in ovaries, adrenal glands and pancreas, and in mast cells. The exact function of this gene is not known, however, available data suggest its role in cell growth, spermiogenesis, vesicular trafficking and secretion. Accumulation of antizyme inhibitor 2 has also been observed in brains of patients with Alzheimer's disease. There has been confusion in literature and databases over the nomenclature of this gene, stemming from an earlier report that a human cDNA clone (identical to ODCp/AZIN2) had arginine decarboxylase (ADC) activity (PMID:14738999). Subsequent studies in human and mouse showed that antizyme inhibitor 2 was devoid of arginine decarboxylase activity (PMID:19956990). Alternatively spliced transcript variants have been described for this gene.
Protein Size (# AA):
460
Molecular Weight:
50kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express AZIN2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express AZIN2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human ADC
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 79%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data:
Anti-ADC (ARP52476_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RHLLENAKKHHVEVVGVSFHIGSGCPDPQAYAQSIADARLVFEMGTELGH
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
OAZ3;
Blocking Peptide:
For anti-AZIN2 (ARP52476_P050) antibody is Catalog # AAP52476 (Previous Catalog # AAPP30314)
Datasheets/Manuals:
Printable datasheet for anti-AZIN2 (ARP52476_P050) antibody

Tell us what you think about this item!

Write A Review
    Please, wait...