Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ATOH1 antibody - middle region (ARP32365_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP32365_P050-FITC Conjugated

ARP32365_P050-HRP Conjugated

ARP32365_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Atonal homolog 1 (Drosophila)
Protein Name:
Protein atonal homolog 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
ATH1, HATH1, MATH-1, bHLHa14
Description of Target:
ATOH1 belongs to the basic helix-loop-helix (BHLH) family of transcription factors. It activates E-box dependent transcription along with E47.This protein belongs to the basic helix-loop-helix (BHLH) family of transcription factors. It activates E-box dependent transcription along with E47. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ATOH1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ATOH1.
The immunogen is a synthetic peptide directed towards the middle region of human ATOH1
Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 85%; Horse: 85%; Human: 100%; Mouse: 92%; Pig: 92%; Rabbit: 83%; Rat: 77%
Complete computational species homology data:
Anti-ATOH1 (ARP32365_P050)
Peptide Sequence:
Synthetic peptide located within the following region: QLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ATOH1 (ARP32365_P050) antibody is Catalog # AAP32365 (Previous Catalog # AAPP03354)
Printable datasheet for anti-ATOH1 (ARP32365_P050) antibody
Target Reference:
Aragaki,M., (2008) Biochem. Biophys. Res. Commun. 368 (4), 923-929

Tell us what you think about this item!

Write A Review
    Please, wait...