Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ASTN2 antibody - N-terminal region : Biotin (ARP46963_P050-Biotin)

Print Page
100 ul
$289.00
In Stock

Conjugation Options

ARP46963_P050 Unconjugated

ARP46963_P050-FITC Conjugated

ARP46963_P050-HRP Conjugated

Gene Symbol:
ASTN2
NCBI Gene Id:
23245
Official Gene Full Name:
Astrotactin 2
Protein Name:
Astrotactin-2
Swissprot Id:
O75129-2
Protein Accession #:
NP_054729
Nucleotide Accession #:
NM_014010
Alias Symbols:
KIAA0634, bA67K19.1
Replacement Item:
This antibody may replace item sc-54863 from Santa Cruz Biotechnology.
Description of Target:
ASTN2 may play an important role in neuronal functioning.
Protein Size (# AA):
1288
Molecular Weight:
142kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB, ICC
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ASTN2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ASTN2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human ASTN2
Species Reactivity:
Guinea Pig, Human, Mouse, Rat
Predicted Homology Based on Immunogen Sequence:
Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Complete computational species homology data:
Anti-ASTN2 (ARP46963_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LLFVRNELPGRIAVQDDLDNTELPFFTLEMSGTAADISLVHWRQQWLENG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Blocking Peptide:
For anti-ASTN2 (ARP46963_P050-Biotin) antibody is Catalog # AAP46963 (Previous Catalog # AAPP27761)
Datasheets/Manuals:
Printable datasheet for anti-ASTN2 (ARP46963_P050-Biotin) antibody
Conjugation:
Biotin
 
X
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...