Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ASTN2 antibody - N-terminal region (ARP46963_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP46963_P050-FITC Conjugated

ARP46963_P050-HRP Conjugated

ARP46963_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Astrotactin 2
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
KIAA0634, bA67K19.1
Replacement Item:
This antibody may replace item sc-54863 from Santa Cruz Biotechnology.
Description of Target:
ASTN2 may play an important role in neuronal functioning.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ASTN2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ASTN2.
The immunogen is a synthetic peptide directed towards the N terminal region of human ASTN2
Species Reactivity:
Guinea Pig, Human, Mouse, Rat
Predicted Homology Based on Immunogen Sequence:
Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Complete computational species homology data:
Anti-ASTN2 (ARP46963_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LLFVRNELPGRIAVQDDLDNTELPFFTLEMSGTAADISLVHWRQQWLENG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-ASTN2 (ARP46963_P050) antibody is Catalog # AAP46963 (Previous Catalog # AAPP27761)
Printable datasheet for anti-ASTN2 (ARP46963_P050) antibody

Tell us what you think about this item!

Write A Review
    Please, wait...