Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ASTN2 antibody - N-terminal region (ARP46963_P050)

Scroll Horizontally to view all Images
Print Page
  • Let us Help: Ask a Question
100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP46963_P050-FITC Conjugated

ARP46963_P050-HRP Conjugated

ARP46963_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Astrotactin 2
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
KIAA0634, bA67K19.1
Replacement Item:
This antibody may replace item sc-54863 from Santa Cruz Biotechnology.
Description of Target:
ASTN2 may play an important role in neuronal functioning.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ASTN2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ASTN2.
The immunogen is a synthetic peptide directed towards the N terminal region of human ASTN2
Species Reactivity:
Guinea Pig, Human, Mouse, Rat
Predicted Homology Based on Immunogen Sequence:
Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Complete computational species homology data:
Anti-ASTN2 (ARP46963_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LLFVRNELPGRIAVQDDLDNTELPFFTLEMSGTAADISLVHWRQQWLENG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-ASTN2 (ARP46963_P050) antibody is Catalog # AAP46963 (Previous Catalog # AAPP27761)
Datasheets / Downloads:
Printable datasheet for anti-ASTN2 (ARP46963_P050) antibody

Customer Reviews for ASTN2 Antibody (ARP46963_P050) tested with mouse cerebellar granule cells in Immunofluorescence

CAT# ARP46963

submitted by:
Hourinaz Behesti
Rockefeller University

How many different experimental trials were conducted using the
antibody sample?

2 immunos, 1 WB

What type of experimental sample are you using and how did you
prepare it?

Human fibroblasts, mouse cerebellar granule cells

What applications did you test the antibody in? Please include
dilutions of the primary and secondary reagents.

WB: did not appear to work
ICC: 1:100 dilution. Alexa 495-conjugated anti Rabbit used as secondary

What controls were used in your experiment? Please include your
positive control.

Positive control: MC7 cells that express Astn2, negative control: no antibody

For IHC, what antigen retrieval method did you use?

none, used 0.05% Triton in the block, and primary incubations

How did you store the antibody after re-suspension?


Please provide the protocol for your application procedure. Please
be as detailed as possible.

1-Block: 5% normal goat serum, 0.05% Triton in PBS 2-Primary incubation: 1:100 for 1 hr at RT
3-2x5 min PBS washes
4-Secondary incubation: 1:300 for 1 hr at RT
5-3x5 min PBS washes
6-mounted with antifade medium

Would you use this antibody in future experiments?


Please explain any problems you had with the antibody and/or
experimental results that Aviva can address in the future.

It does not detect the band at ~115 kDa for Astn2, which I am able to detect with our own home-made antibody.

If the antibody works, do you plan to use it in future experiments
or to publish your data? Why or why not?

Yes if I can verify that it binds to Astn2 specifically

Product Protocols: ASTN2 antibody tested with Human Fetal Liver Tissue (ARP46963_P050)

Aviva Systems Biology is the original manufacturer of this ASTN2 antibody (ARP46963_P050)

Click here to view the ASTN2 antibody Western Blot Protocol

Product Datasheet Link: ASTN2 antibody (ARP46963_P050)

WB Suggested Anti-ASTN2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Fetal Liver

Western Blot image:

Description of Target: ASTN2 may play an important role in neuronal functioning.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s ASTN2 antibody (ARP46963_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...