Aviva Systems Biology office will be closed for Thanksgiving Holiday - November 22-23, 2018.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

APOPT1 Antibody - C-terminal region (ARP69014_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock

Conjugation Options

ARP69014_P050-FITC Conjugated

ARP69014_P050-HRP Conjugated

ARP69014_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
APOPT1
NCBI Gene Id:
84334
Protein Name:
Apoptogenic protein 1, mitochondrial
Swissprot Id:
Q96IL0
Protein Accession #:
NP_115750
Nucleotide Accession #:
NM_032374
Alias Symbols:
APOP1, C14orf153
Description of Target:
APOPT1 plays a role in the regulation of apoptosis. It mediates mitochondria-induced cell death in vascular smooth muscle cells through the release of cytochrome c from mitochondria, followed by the activation of the caspase cascade.
Protein Size (# AA):
206
Molecular Weight:
20kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express APOPT1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express APOPT1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human APOPT1
Species Reactivity:
Cow, Horse, Human
Predicted Homology Based on Immunogen Sequence:
Cow: 82%; Horse: 82%; Human: 100%
Peptide Sequence:
Synthetic peptide located within the following region: KEFLSKNFQKHMYYNRDWYKRNFAITFFMGKVALERIWNKLKQKQKKRSN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
BAG3; UBC;
Blocking Peptide:
For anti-APOPT1 (ARP69014_P050) antibody is Catalog # AAP69014
Datasheets/Manuals:
Printable datasheet for anti-APOPT1 (ARP69014_P050) antibody
Average Rating:
1 review
5 star
0
4 star
1
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

128/05/2018 19:29
  • Quality:
  • Overall Experience:
HEK-293 Cell lysates in WB

Submitted by: Anonymous

APOPT1

1.             Sample Type/Lane Description:

Human HEK293 Cell Lysates

Lane 1: 40 ug untreated HEK293 cells (control)

Lane 2: 40 ug HEK293 cells + OA (Oligomycin + AntimycinA)

Lane 3: 40 ug HEK293 cells + CCCP

Lane 4: 40 ug HEK293 cells + Staurosporine

2.      Primary antibody dilution:

1:500

3.    Secondary antibody and dilution:

HRP-Goat anti-Rabbit IgG - 1:10,000

4.     Protocol:

HEK293 control cells, as well as cells treated with OA, CCCP, Staurosporine were lysed using a Triton X-100 based lysis buffer (1% Triton X-100, 10% glycerol, 150 mM NaCl, 20 mM Tris (pH 7.5), 2 mM EDTA) in the presence of a protease inhibitor mix. 40 μg of whole cell extract was mixed with 2 × SDS-sample buffer and boiled for 5 min. The samples were resolved on 12% SDS-PAGE and electro-transferred PVDF membranes using a semi-dry cell transfer blot. 4% nonfat dry milk in TBST buffer (25 mM Tris–HCl, pH 8.0, 125 mM NaCl, 0.1% Tween 20) was used to block nonspecific binding of the membrane. The membrane was incubated overnight at 4oC with TECPR1 (1:500 in TBST+ 4%Milk) primary antibodies followed by the specific secondary peroxidase-conjugated antibodies. The membrane was visualized by enhanced chemiluminescence (ECL) and developed using X-ray film.

0
0
Reply
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...