Now Offering Over 102,157 Antibodies & 44,722 Antigens!

AMFR antibody - C-terminal region (ARP42995_T100)

Print Page
100 ul

Regular Price: $229.00

Special Price: $215.00

In Stock

Conjugation Options

ARP42995_T100-FITC Conjugated

ARP42995_T100-HRP Conjugated

ARP42995_T100-Biotin Conjugated

Gene Symbol:
AMFR
NCBI Gene Id:
267
Official Gene Full Name:
Autocrine motility factor receptor, E3 ubiquitin protein ligase
Protein Name:
AMFR protein EMBL AAH56869.1
Swissprot Id:
Q9UKV5
Protein Accession #:
AAH56869
Nucleotide Accession #:
NM_013446
Alias Symbols:
GP78, RNF45
Replacement Item:
This antibody may replace item sc-21565 from Santa Cruz Biotechnology.
Description of Target:
Autocrine motility factor is a tumor motility-stimulating protein secreted by tumor cells. AMFR is a glycosylated transmembrane protein and a receptor for autocrine motility factor. The receptor, which shows some sequence similarity to tumor protein p53, is localized to the leading and trailing edges of carcinoma cells.The Makorin ring finger protein-1 gene (MKRN1) is a highly transcribed, intron-containing source for a family of intronless mammalian genes encoding a novel class of zinc finger proteins. Phylogenetic analyses indicate that the MKRN1 gene is the ancestral founder of this gene family (Gray et al., 2000).[supplied by OMIM].
Protein Size (# AA):
643
Molecular Weight:
73kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express AMFR.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express AMFR.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human AMFR
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-AMFR (ARP42995_T100)
Peptide Sequence:
Synthetic peptide located within the following region: FGEVEVEPSEVEDFEARGSRFSKSADERQRMLVQRKDELLQQARKRFLNK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
VCP; UBE2G1; HSPA5; ERLIN2; INSIG1; HMGCR; DHFR; AMFR; UBE2D1; UBC; GPI; TRIM25; DGAT2; UBE2K; Ube2g2; NPLOC4; HERPUD1; BAG6; MAVS; YOD1; ADRA1D; DERL2; ADRB2; FAF2; SEC61B; RPN1; STT3A; STT3B; AUP1; MDC1; SNED1; DDOST; GET4; UBXN4; UBL4A; CD82; SARAF; IT
Blocking Peptide:
For anti-AMFR (ARP42995_T100) antibody is Catalog # AAP43141 (Previous Catalog # AAPP11301)
Datasheets/Manuals:
Printable datasheet for anti-AMFR (ARP42995_T100) antibody
Sample Type Confirmation:

AMFR is supported by BioGPS gene expression data to be expressed in HepG2

Target Reference:
Lehner,B. (2004) Genome Res. 14 (7), 1315-1323
 
X
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...