Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ALGL Recombinant Protein (Azotobacter vinelandii) (OPCA05138)

* Required Fields

$0.00
In Stock
Gene Symbol:
ALGL
Alias Symbols:
Poly(beta-D-mannuronate) lyase
Description of Target:
Catalyzes the depolymerization of alginate by cleaving the beta-1,4 glycosidic bond between two adjacent sugar residues via a beta-elimination mechanism. Splits ManA-ManA and ManA-GulA bonds, but not GulA-ManA or GulA-GulA bonds. Also cleaves acetylated residues.
Swissprot Id:
O52195
Protein Accession #:
WP_012699742
Nucleotide Accession #:
NZ_FPKM01000036
Protein Name:
Alginate lyase
Molecular Weight:
59 kDa
Product Format:
Liquid
Species Reactivity:
Azotobacter vinelandii
Formulation:
Tris-base, 50% glycerol
Purity:
Greater than 90% as determined by SDS-PAGE.
Protein Sequence:
Full Length of Mature Protein: AEALVPPKGYYAPVDIRKGEAPACPVVPEPFTGELVFRSKYEGSDAARSTLNEEAEKAFRTKTAPITQIERGVSRMVMRYMEKGRAGDLECTLAWLDAWAEDGALLTTEYNHTGKSMRKWALGSLAGAYLRLKFSSSQPLAAYPEQARRIESWFAKVGDQVIKDWSDLPLKRINNHSYWAAWAVMAAGVATNRRPLFDWAVEQFHIAAGQVDSNGFLPNELKRRQRALAYHNYSLPPLMMVAAFALANGVDLRGDNDGALGRLAGNVLAGVEKPEPFAERAGDEDQDMEDLETDAKFSWLEPYCALYSCSPALRERKAEMGPFKNFRLGGDVTRIFDPAEKSPRSTVGKRD
Storage Buffer:
Tris-base, 50% glycerol
Source:
E.coli
Additional Information:
Species Specificity Detail: Azotobacter vinelandii
Tag:
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Reconstitution and Storage:
Store at -20/-80C for 12 months. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Target Reference:
Biochemical properties and substrate specificities of a recombinantly produced Azotobacter vinelandii alginate lyase.
Ertesvag H., Erlien F., Skjak-Braek G., Rehm B.H., Valla S.
J. Bacteriol. 180:3779-3784(1998)
Datasheets/Manuals:
Printable datasheet for OPCA05138
Protocol:
Tips Information:

Tell us what you think about this item!

Write A Review
    Please, wait...