Now Offering Over 102,157 Antibodies & 44,722 Antigens!

AHR antibody - N-terminal region (ARP31635_T100)

100 ul

Regular Price: $229.00

Special Price: $215.00

In Stock

Conjugation Options

ARP31635_T100-FITC Conjugated

ARP31635_T100-HRP Conjugated

ARP31635_T100-Biotin Conjugated

Gene Symbol:
AHR
NCBI Gene Id:
196
Official Gene Full Name:
Aryl hydrocarbon receptor
Protein Name:
Aryl hydrocarbon receptor
Swissprot Id:
P35869
Protein Accession #:
NP_001612
Nucleotide Accession #:
NM_001621
Alias Symbols:
bHLHe76
Replacement Item:
This antibody may replace item sc-101104 from Santa Cruz Biotechnology.
Description of Target:
Aryl hydrocarbon receptor (AHR) is a ligand-activated transcription factor involved in the regulation of biological responses to planar aromatic hydrocarbons. AHR has been shown to regulate xenobiotic-metabolizing enzymes such as cytochrome P450. AHR ligands included a variety of aromatic hydrocarbons.
Protein Size (# AA):
848
Molecular Weight:
96kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express AHR.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express AHR.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human AHR
Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-AHR (ARP31635_T100)
Peptide Sequence:
Synthetic peptide located within the following region: MNSSSANITYASRKRRKPVQKTVKPIPAEGIKSNPSKRHRDRLNTELDRL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
GNA13; UBC; NFE2L2; MAF; RB1; EP300; ARNT; NCOA2; NCOA1; TBP; TAF9; TAF6; TAF4; NCOA7; NCOR2; BRCA1; IVNS1ABP; AIP; STUB1; AHR; FOXA1; SUMO2; DDB1; CTNNB1; TAF7; PTGES3; SMARCA4; NEDD8; XPO1; ARNTL; CCNT1; NRIP1; DAP3; AR; CUL4B; GTF2F2; RELA; HSP90AA1; E
Blocking Peptide:
For anti-AHR (ARP31635_T100) antibody is Catalog # AAP31635 (Previous Catalog # AAPP02422)
Datasheets/Manuals:
Printable datasheet for anti-AHR (ARP31635_T100) antibody
Target Reference:
Marlowe,J.L., et al., (2004) J. Biol. Chem. 279 (28), 29013-29022
Average Rating:
1 review
5 star
0
4 star
1
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

02/01/2017 16:23
  • Overall Experience:
  • Quality:
Product Review: AHR antibody-N-terminal region (ARP31635_T100) in Human HepG2 cells using Western Blot
Product Page for AHR antibody-N-terminal region (ARP31635_T100)

Application: Western blotting
Species + Tissue/Cell type: Human HepG2 cells
How many ug's of tissue/cell lysate run on the gel:
1: 50 ug HepG2 nuclei extract + benzo[a]pyrene
2: 50 ug HepG2 cytoplasm extract + benzo[a]pyrene
Primary antibody dilution: 1:1000
Secondary antibody: Anti-rabbit HRP
Secondary antibody dilution: 1:1000



Questionnaire

How do Aviva's reagents play a role in your experimental goals?

Arylhydrocarbon receptor.

How would you rate this antibody on a scale from 1-5 (5=best) and why?

4=good; recognized a single band on WB.

Would you use this antibody in future experiments?

Yes

Have you used another antibody which has worked in your application?

Yes

Do you believe the information about the reagent on Aviva's website is correct?

Yes

If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not?

Yes. The data was recently published in JCB Epub ahead of print; Chavan and Krishnamurthy. 2012

How did you store the antibody after re-suspension?

As recommended.

Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel):

Human, HepG2 cells, 50 ug

How many different experimental trials were conducted using the antibody sample?

3 trials

How was this sample prepared?

Total lysate following cell harvest and sonication.

Primary antibody dilution and incubation time:

1:1000; overnight.

Secondary antibody used and dilution and incubation time:

1:1000; 2h.

What controls were used in your experiment (positive/negative)?

AhR knockdown cells.

Please include your detailed WB Procedure/Protocol here:

50 microgram total protein (cell lysate) analyzed vis SDS-PAGE (10% resolving gel).

Standard transfer to PVDF membrane.

Primary antibody and secondary antibody as described above.

ECL analysis of signals.
0
0
Reply
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...