Now Offering Over 102,157 Antibodies & 44,722 Antigens!

AGTR1 antibody - N-terminal region (ARP42198_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP42198_P050-FITC Conjugated

ARP42198_P050-HRP Conjugated

ARP42198_P050-Biotin Conjugated

Gene Symbol:
AGTR1
NCBI Gene Id:
185
Official Gene Full Name:
Angiotensin II receptor, type 1
Protein Name:
Type-1 angiotensin II receptor
Swissprot Id:
P30556
Protein Accession #:
NP_004826
Nucleotide Accession #:
NM_004835
Alias Symbols:
AG2S, AGTR1A, AGTR1B, AT1, AT1B, AT2R1, AT2R1A, AT2R1B, HAT1R, AT1R
Replacement Item:
This antibody may replace item sc-1173-G from Santa Cruz Biotechnology.
Description of Target:
Angiotensin II is a potent vasopressor hormone and a primary regulator of aldosterone secretion. It is an important effector controlling blood pressure and volume in the cardiovascular system. It acts through at least two types of receptors. AGTR1 is the type 1 receptor which is thought to mediate the major cardiovascular effects of angiotensin II. AGTR1 may play a role in the generation of reperfusion arrhythmias following restoration of blood flow to ischemic or infarcted myocardium. It was previously thought that a related gene, denoted as AGTR1B, existed; however, it is now believed that there is only one type 1 receptor gene in humans.Angiotensin II is a potent vasopressor hormone and a primary regulator of aldosterone secretion. It is an important effector controlling blood pressure and volume in the cardiovascular system. It acts through at least two types of receptors. This gene encodes the type 1 receptor which is thought to mediate the major cardiovascular effects of angiotensin II. This gene may play a role in the generation of reperfusion arrhythmias following restoration of blood flow to ischemic or infarcted myocardium. It was previously thought that a related gene, denoted as AGTR1B, existed; however, it is now believed that there is only one type 1 receptor gene in humans. At least five transcript variants have been described for this gene. Additional variants have been described but their full-length nature has not been determined. The entire coding sequence is contained in the terminal exon and is present in all transcript variants.
Protein Size (# AA):
359
Molecular Weight:
41kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express AGTR1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express AGTR1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human AGTR1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Complete computational species homology data:
Anti-AGTR1 (ARP42198_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ILNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
PDE6H; GNB2L1; HTR2B; ARRB2; ARRB1; JAK2; TRAF3; MAPK1; AGTRAP; DNAJC14; THOP1; GRK5; GPRASP1; HRAS; RAB5A; PLCG1; RAF1; NOS3; EGFR; BDKRB2; ADRBK2; ADRBK1; AGT; ZBTB16;
Blocking Peptide:
For anti-AGTR1 (ARP42198_P050) antibody is Catalog # AAP42198 (Previous Catalog # AAPP12578)
Datasheets/Manuals:
Printable datasheet for anti-AGTR1 (ARP42198_P050) antibody
Target Reference:
Kurland,L., (2008) Am. J. Hypertens. 21 (7), 836-839

Tell us what you think about this item!

Write A Review
    Please, wait...