Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ADORA2A antibody - C-terminal region (ARP59953_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP59953_P050-FITC Conjugated

ARP59953_P050-HRP Conjugated

ARP59953_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
ADORA2A
NCBI Gene Id:
135
Official Gene Full Name:
Adenosine A2a receptor
Protein Name:
Adenosine receptor A2a
Swissprot Id:
P29274
Protein Accession #:
NP_000666
Nucleotide Accession #:
NM_000675
Alias Symbols:
ADORA2, RDC8, hA2aR
Description of Target:
ADORA2A is one of several receptor subtypes for adenosine. The activity of the protein, a G-protein coupled receptor family member, is mediated by G proteins which activate adenylyl cyclase. ADORA2A is abundant in basal ganglia, vasculature and platelets and it is a major target of caffeine.
Protein Size (# AA):
412
Molecular Weight:
45kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ADORA2A.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ADORA2A.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human ADORA2A
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 80%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Complete computational species homology data:
Anti-ADORA2A (ARP59953_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
NAMPT; Actn1; Actn4; Actn3; Actn2; ADORA2A; CYTH2; DRD2; ADA;
Blocking Peptide:
For anti-ADORA2A (ARP59953_P050) antibody is Catalog # AAP59953 (Previous Catalog # AAPP46115)
Datasheets/Manuals:
Printable datasheet for anti-ADORA2A (ARP59953_P050) antibody
Sample Type Confirmation:

ADORA2A is supported by BioGPS gene expression data to be expressed in RPMI 8226

Tell us what you think about this item!

Write A Review
    Please, wait...