Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ADGRL1 Antibody - C-terminal region : HRP (ARP65781_P050-HRP)

100 ul
In Stock

Conjugation Options

ARP65781_P050 Unconjugated

ARP65781_P050-FITC Conjugated

ARP65781_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
adhesion G protein-coupled receptor L1
Protein Name:
adhesion G protein-coupled receptor L1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-34484 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a member of the latrophilin subfamily of G-protein coupled receptors (GPCR). Latrophilins may function in both cell adhesion and signal transduction. In experiments with non-human species, endogenous proteolytic cleavage within a cysteine-rich GPS (G-protein-coupled-receptor proteolysis site) domain resulted in two subunits (a large extracellular N-terminal cell adhesion subunit and a subunit with substantial similarity to the secretin/calcitonin family of GPCRs) being non-covalently bound at the cell membrane. Latrophilin-1 has been shown to recruit the neurotoxin from black widow spider venom, alpha-latrotoxin, to the synapse plasma membrane. Alternative splicing results in multiple variants encoding distinct isoforms.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ADGRL1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ADGRL1.
The immunogen is a synthetic peptide directed towards the C-terminal region of Human LPHN1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 86%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 100%
Complete computational species homology data:
Anti-LPHN1 (ARP65781_P050)
Peptide Sequence:
Synthetic peptide located within the following region: YSLRSGDFPPGDGGPEPPRGRNLADAAAFEKMIISELVHNNLRGSSSAAK
Product Format:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
0.6-0.7 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ADGRL1 (ARP65781_P050-HRP) antibody is Catalog # AAP65781
Printable datasheet for anti-ADGRL1 (ARP65781_P050-HRP) antibody

Tell us what you think about this item!

Write A Review
    Please, wait...