Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ACTB Antibody - middle region (ARP40174_P050)

100 ul

Regular Price: $289.00

Special Price: $215.00

In Stock

Conjugation Options

ARP40174_P050-FITC Conjugated

ARP40174_P050-HRP Conjugated

ARP40174_P050-Biotin Conjugated

Gene Symbol:
ACTB
NCBI Gene Id:
60
Official Gene Full Name:
Actin, beta
Protein Name:
Actin, cytoplasmic 1
Swissprot Id:
P60709
Protein Accession #:
NP_001092
Nucleotide Accession #:
NM_001101
Alias Symbols:
BRWS1, PS1TP5BP1
Replacement Item:
This antibody may replace item sc-10731 from Santa Cruz Biotechnology.
Description of Target:
This protein is one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, and integrity. This actin is a major constituent of the contractile apparatus and one of the two nonmuscle cytoskeletal actins.
Protein Size (# AA):
375
Molecular Weight:
42kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ACTB.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ACTB.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of Human ACTB
Species Reactivity:
Cow, Goat, Horse, Human, Mouse, Pig, Rat, Sheep, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-ACTB (ARP40174_P050)
Peptide Sequence:
Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and may contain up to 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
FUS; DSTN; CAP2; CFL2; CFL1; ACTG1; ACTB; PA2G4; EHHADH; WDYHV1; HDAC6; ISG15; TP53; CEP250; TUBGCP2; TUBGCP3; VCP; UBC; TUBG1; SUMO2; LGALS3BP; AMOT; NEDD1; HAUS1; IVNS1ABP; STAU1; MDM2; CORO7; LGR4; ASB12; ASB9; ZBTB1; ERG; RPA3; RPA2; RPA1; CDKN2A; PAR
Blocking Peptide:
For anti-ACTB (ARP40174_P050) antibody is Catalog # AAP40174
Datasheets/Manuals:
Printable datasheet for anti-ACTB (ARP40174_P050) antibody
Sample Type Confirmation:

ACTB is strongly supported by BioGPS gene expression data to be expressed in HeLa, HepG2, Jurkat, MCF7

Additional Information:
IHC Information: Paraffin embedded breast tissue, tested with an antibody dilution of 5 ug/ml.
Publications:

Phungphong, S; Kijtawornrat, A; Wattanapermpool, J; Bupha-Intr, T; Regular exercise modulates cardiac mast cell activation in ovariectomized rats. 66, 165-73 (2016). IHC, WB, Cow, Goat, Horse, Human, Mouse, Pig, Rat, Sheep, Zebrafish 26467449

Tell us what you think about this item!

Write A Review
    Please, wait...