Now Offering Over 102,157 Antibodies & 44,722 Antigens!

AaH2 Recombinant Protein (OPCA03379)

* Required Fields

$0.00
In Stock
Swissprot Id:
P01484
Host:
Androctonus australis
Molecular Weight:
23 kDa
Product Format:
Liquid
Formulation:
20 mM Tris-HCl based buffer, pH 8.0
Purity:
Greater than 90% as determined by SDS-PAGE.
Protein Sequence:
VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH
Storage Buffer:
20 mM Tris-HCl based buffer, pH 8.0
Source:
E.coli
Additional Information:
Relevance: Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. This toxin is active against mammals.
Tag:
His-SUMO-tag
Reconstitution and Storage:
Store at -20C. Avoid freeze thaw cycles.
Target Reference:
"Precursors of Androctonus australis scorpion neurotoxins. Structures of precursors, processing outcomes, and expression of a functional recombinant toxin II."
Bougis P.E., Rochat H., Smith L.A.
J. Biol. Chem. 264:19259-19265(1989)
Datasheets/Manuals:
Printable datasheet for AaH2 Recombinant Protein (Androctonus australis) (OPCA03379)
Protocol:
Tips Information:

Tell us what you think about this item!

Write A Review
    Please, wait...