Now Offering Over 102,157 Antibodies & 44,722 Antigens!

A830053O21Rik antibody - middle region (ARP37562_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP37562_P050-FITC Conjugated

ARP37562_P050-HRP Conjugated

ARP37562_P050-Biotin Conjugated

Gene Symbol:
Bhlha9
NCBI Gene Id:
320522
Official Gene Full Name:
Basic helix-loop-helix family, member a9
Protein Name:
Class A basic helix-loop-helix protein 9
Swissprot Id:
Q5RJB0
Protein Accession #:
NP_796156
Nucleotide Accession #:
NM_177182
Alias Symbols:
A830053O21Rik, RP23-343C18.1
Replacement Item:
This antibody may replace item sc-241913 from Santa Cruz Biotechnology.
Description of Target:
The function of this protein remains unknown.
Protein Size (# AA):
168
Molecular Weight:
18kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express A830053O21Rik.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express A830053O21Rik.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of mouse A830053O21Rik
Species Reactivity:
Mouse
Predicted Homology Based on Immunogen Sequence:
Mouse: 100%
Complete computational species homology data:
Anti-A830053O21Rik (ARP37562_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RKRERPTRSKARRMAANVRERKRILDYNEAFNALRRALQHDLGGKRLSKI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Bhlha9 (ARP37562_P050) antibody is Catalog # AAP37562 (Previous Catalog # AAPP09668)
Datasheets/Manuals:
Printable datasheet for anti-Bhlha9 (ARP37562_P050) antibody

Tell us what you think about this item!

Write A Review
    Please, wait...