Aviva Systems Biology office will be closed for Thanksgiving Holiday - November 22-23, 2018.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

9030625A04Rik antibody - C-terminal region (ARP53140_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$319.00
In Stock

Conjugation Options

ARP53140_P050-FITC Conjugated

ARP53140_P050-HRP Conjugated

ARP53140_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
Lacc1
NCBI Gene Id:
210808
Official Gene Full Name:
RIKEN cDNA 9030625A04 gene
Protein Name:
Laccase domain-containing protein 1
Swissprot Id:
Q8BZT9
Protein Accession #:
NP_766076
Nucleotide Accession #:
NM_172488
Alias Symbols:
Lacc1, 9030625A04Rik
Description of Target:
The function of this protein remains unknown.
Protein Size (# AA):
430
Molecular Weight:
47kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express 9030625A04Rik.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express 9030625A04Rik.
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data:
Anti-9030625A04Rik (ARP53140_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LERGGILPQNIQDQKEDLDLCTSCHPEKFFSHVRDGLNFGTQIGFISLRE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Lacc1 (ARP53140_P050) antibody is Catalog # AAP53140 (Previous Catalog # AAPP36209)
Datasheets/Manuals:
Printable datasheet for anti-Lacc1 (ARP53140_P050) antibody

Tell us what you think about this item!

Write A Review
    Please, wait...