Aviva Systems Biology office will be closed for Thanksgiving Holiday - November 22-23, 2018.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

5HT2A RECEPTOR Antibody - C-terminal region (OABB02082)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ug
$320.00
In Stock
Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
5HT2A RECEPTOR
NCBI Gene Id:
3356
Official Gene Full Name:
5-hydroxytryptamine receptor 2A
Swissprot Id:
P28223
Alias Symbols:
HTR2, 5-HT2A
Description of Target:
The mammalian HTR2A (5-HT2A receptor) is a subtype of the 5-HT2 receptor that belongs to the serotonin receptor family and is a G protein-coupled receptor (GPCR). This is the main excitatory receptor subtype among the GPCRs for serotonin (5-HT), although 5-HT2A may also have an inhibitory effect on certain areas such as the visual cortex and the orbit frontal cortex. This receptor was given importance first as the target of psychedelic drugs like LSD. Later it came back to prominence because it was also found to be mediating, at least partly, the action of many antipsychotic drugs, especially the atypical ones.5-HT2A also happens to be a necessary receptor for the spread of the human polyoma virus called JC virus. Sparkes et al. (1991) concluded that the gene is located on 13q14-q21 in man and on chromosome 14 in the mouse.
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Immunogen affinity purified.
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express 5HT2A RECEPTOR.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express 5HT2A RECEPTOR.
Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human 5HT2A Receptor (400-431aa KENKKPLQLILVNTIPALAYKSSQLQMGQKKN) , different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.
Species Reactivity:
Human, Rat
Peptide Sequence:
Synthetic peptide located within the following region: KENKKPLQLILVNTIPALAYKSSQLQMGQKKN
Product Format:
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Reconstitution and Storage:
Add 0.2 ml of distilled water will yield a concentration of 500 ug/ml. +4C
Datasheets/Manuals:
Printable datasheet for anti-5HT2A RECEPTOR (OABB02082) antibody
Isotype:
IgG
Application Info:
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Target Reference:
1. Cook EH, Fletcher KE, Wainwright M, Marks N, Yan SY, Leventhal BL (August 1994). "Primary structure of the human platelet serotonin 5-HT2 receptor: identity with frontal cortex serotonin 5-HT2A receptor". J. Neurochem. 63 (2): 465–9.
2. Elphick GF, Querbes W, Jordan JA, Gee GV, Eash S, Manley K, Dugan A, Stanifer M, Bhatnagar A, Kroeze WK, Roth BL, Atwood WJ (2004). "The human polyomavirus, JCV, uses serotonin receptors to infect cells". Science 306 (5700): 1380–3.
Protocol:
Tips Information:

Tell us what you think about this item!

Write A Review
    Please, wait...