Now Offering Over 102,157 Antibodies & 44,722 Antigens!

5930431H10 antibody - C-terminal region (ARP37654_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock

Conjugation Options

ARP37654_P050-FITC Conjugated

ARP37654_P050-HRP Conjugated

ARP37654_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
5930431H10
NCBI Gene Id:
244690
Official Gene Full Name:
Hypothetical protein 5930431H10
Protein Accession #:
XP_486185
Nucleotide Accession #:
XM_486185
Alias Symbols:
-
Description of Target:
The function of this protein remains unknown.
Protein Size (# AA):
414
Molecular Weight:
46kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express 5930431H10.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express 5930431H10.
Immunogen:
The immunogen is a synthetic peptide directed towards the c terminal region of human 5930431H10
Species Reactivity:
Guinea Pig, Horse, Mouse, Rat
Predicted Homology Based on Immunogen Sequence:
Guinea Pig: 79%; Horse: 79%; Mouse: 100%; Rat: 86%
Complete computational species homology data:
Anti-5930431H10 (ARP37654_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PSPLGANNGNNVATFGAGSAGSSQQLRPNLAHSLSGMSAQRSSTVMITAN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-5930431H10 (ARP37654_P050) antibody is Catalog # AAP37654 (Previous Catalog # AAPS05909)
Datasheets/Manuals:
Printable datasheet for anti-5930431H10 (ARP37654_P050) antibody

Tell us what you think about this item!

Write A Review
    Please, wait...