Now Offering Over 102,157 Antibodies & 44,722 Antigens!

5730409E04Rik antibody - C-terminal region (ARP52923_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock

Conjugation Options

ARP52923_P050-FITC Conjugated

ARP52923_P050-HRP Conjugated

ARP52923_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
RIKEN cDNA 5730409E04Rik gene
Protein Name:
UPF0500 protein C1orf216 homolog
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
AI849033, 7530403E16Rik
Description of Target:
The function remains unknown.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express 5730409E04Rik.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express 5730409E04Rik.
The immunogen is a synthetic peptide corresponding to a region of Mouse
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 100%
Complete computational species homology data:
Anti-5730409E04Rik (ARP52923_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RLALLQWIRALQHQLVDQQARLQESFDTILDNRKELIRCLQQREAPCRHQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-5730409E04Rik (ARP52923_P050) antibody is Catalog # AAP52923 (Previous Catalog # AAPP34909)
Printable datasheet for anti-5730409E04Rik (ARP52923_P050) antibody

Tell us what you think about this item!

Write A Review
    Please, wait...