Now Offering Over 102,157 Antibodies & 44,722 Antigens!

4930572J05Rik Antibody - C-terminal region (ARP47289_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock

Conjugation Options

ARP47289_P050-FITC Conjugated

ARP47289_P050-HRP Conjugated

ARP47289_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
Them6
NCBI Gene Id:
223626
Official Gene Full Name:
RIKEN cDNA 4930572J05 gene
Protein Name:
UPF0670 protein THEM6 homolog
Swissprot Id:
Q80ZW2
Protein Accession #:
NP_941009
Nucleotide Accession #:
NM_198607
Alias Symbols:
MGC54796, 4930572J05Rik
Description of Target:
The function of this protein remains unknown.
Protein Size (# AA):
207
Molecular Weight:
24kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express 4930572J05Rik.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express 4930572J05Rik.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse 4930572J05Rik
Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 93%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Rat: 100%
Complete computational species homology data:
Anti-4930572J05Rik (ARP47289_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RRSLRLFEPFEVHTRLQGWDDRAFYLEARFVSLRDGFVCALLRFRQHVLG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
THEM6; SPRR2G; SPRR2E; SPRR2D; SPRR2B; PRKDC;
Blocking Peptide:
For anti-Them6 (ARP47289_P050) antibody is Catalog # AAP47289
Datasheets/Manuals:
Printable datasheet for anti-Them6 (ARP47289_P050) antibody

Tell us what you think about this item!

Write A Review
    Please, wait...