Now Offering Over 102,157 Antibodies & 44,722 Antigens!

4930567H17Rik antibody - middle region (ARP31541_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock

Conjugation Options

ARP31541_P050-FITC Conjugated

ARP31541_P050-HRP Conjugated

ARP31541_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
4930567H17Rik
NCBI Gene Id:
619303
Official Gene Full Name:
RIKEN cDNA 4930567H17 gene
Protein Name:
Protein 4930567H17Rik Ensembl ENSMUSP00000090060
Swissprot Id:
Q3V0K5
Protein Accession #:
NP_001028979
Nucleotide Accession #:
NM_001033807
Alias Symbols:
-
Description of Target:
The function of this protein remains unknown.
Protein Size (# AA):
233
Molecular Weight:
27kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express 4930567H17Rik.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express 4930567H17Rik.
Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 86%; Horse: 92%; Human: 100%; Mouse: 100%; Pig: 92%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-4930567H17Rik (ARP31541_P050)
Peptide Sequence:
Synthetic peptide located within the following region: TLSSYDPCRYILKAALSVITAWENTLEEEEEDEEEDEEEEEMEEEDEGEE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-4930567H17Rik (ARP31541_P050) antibody is Catalog # AAP31541
Datasheets/Manuals:
Printable datasheet for anti-4930567H17Rik (ARP31541_P050) antibody

Tell us what you think about this item!

Write A Review
    Please, wait...