Now Offering Over 102,157 Antibodies & 44,722 Antigens!

4732418C07Rik Antibody - C-terminal region (ARP47074_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock

Conjugation Options

ARP47074_P050-FITC Conjugated

ARP47074_P050-HRP Conjugated

ARP47074_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
Efcab14
NCBI Gene Id:
230648
Official Gene Full Name:
RIKEN cDNA 4732418C07 gene
Protein Name:
Novel protein EMBL CAM15277.1
Swissprot Id:
Q6PCQ6
Protein Accession #:
NP_766286
Nucleotide Accession #:
NM_172698
Alias Symbols:
KIAA0494, Kiaa0494, RP23-146I18.2, 4732418C07Rik
Description of Target:
The function of this protein remains unknown.
Protein Size (# AA):
529
Molecular Weight:
59kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express 4732418C07Rik.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express 4732418C07Rik.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of 4732418C07Rik
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data:
Anti-4732418C07Rik (ARP47074_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ISALTNKPESNRPPETTDEEQVQNFTSDPSALPEFSQLLRNQIETQVKPL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Efcab14 (ARP47074_P050) antibody is Catalog # AAP47074
Datasheets/Manuals:
Printable datasheet for anti-Efcab14 (ARP47074_P050) antibody

Tell us what you think about this item!

Write A Review
    Please, wait...