Now Offering Over 102,157 Antibodies & 44,722 Antigens!

2810405K02Rik antibody - middle region (ARP52920_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock

Conjugation Options

ARP52920_P050-FITC Conjugated

ARP52920_P050-HRP Conjugated

ARP52920_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
Fam213b
NCBI Gene Id:
66469
Official Gene Full Name:
RIKEN cDNA 2810405K02 gene
Protein Name:
Prostamide/prostaglandin F synthase
Swissprot Id:
Q9DB60
Protein Accession #:
NP_079858
Nucleotide Accession #:
NM_025582
Alias Symbols:
Fam213b, PM/PGFS, AI836168, RP23-15L19.6, 2810405K02Rik
Description of Target:
2810405K02Rik catalyzes the reduction of prostaglandin-ethanolamide H2 (prostamide H2) to prostamide F(2alpha) with NADPH as proton donor. It also be able to reduce prostaglandin H2 to prostaglandin F(2alpha).
Protein Size (# AA):
201
Molecular Weight:
22kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express 2810405K02Rik.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express 2810405K02Rik.
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 100%
Complete computational species homology data:
Anti-2810405K02Rik (ARP52920_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SKQIYKELGFKRYNSLSILPAALGKPVRDVASKAKAVGIQGNLSGDLLQS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Fam213b (ARP52920_P050) antibody is Catalog # AAP52920 (Previous Catalog # AAPP34906)
Datasheets/Manuals:
Printable datasheet for anti-Fam213b (ARP52920_P050) antibody

Tell us what you think about this item!

Write A Review
    Please, wait...