Now Offering Over 102,157 Antibodies & 44,722 Antigens!

1700047I17RIK2 Antibody - middle region (ARP95829_P050)

100 ul
$289.00
In Stock
Gene Symbol:
1700047I17RIK2
NCBI Gene Id:
100101807
Official Gene Full Name:
RIKEN cDNA 1700047I17 gene 2
Protein Name:
protein FAM177A1
Swissprot Id:
Q8BR63
Protein Accession #:
NP_001093586.1
Nucleotide Accession #:
NM_001100116.1
Protein Size (# AA):
207
Molecular Weight:
22 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express 1700047I17RIK2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express 1700047I17RIK2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of mouse FAM177A1
Species Reactivity:
Mouse
Peptide Sequence:
Synthetic peptide located within the following region: YYRMKKEEEEEEEENRMSEEAERQYQQNKLQADSIVQTDQPETVSSSFVN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-1700047I17RIK2 (ARP95829_P050) antibody is Catalog # AAP95829
Datasheets/Manuals:
Printable datasheet for anti-1700047I17RIK2 (ARP95829_P050) antibody

Tell us what you think about this item!

Write A Review
    Please, wait...