Now Offering Over 102,157 Antibodies & 44,722 Antigens!

1700026L06Rik Antibody - C-terminal region (ARP53733_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
$289.00
In Stock

Conjugation Options

ARP53733_P050-FITC Conjugated

ARP53733_P050-HRP Conjugated

ARP53733_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
1700026L06Rik
NCBI Gene Id:
69987
Official Gene Full Name:
chromosome 9 open reading frame 9
Protein Name:
Uncharacterized protein C9orf9 homolog
Swissprot Id:
Q7TPM5
Protein Accession #:
NP_081559
Nucleotide Accession #:
NM_027283
Alias Symbols:
-
Description of Target:
The function of this protein remains unknown.
Protein Size (# AA):
168
Molecular Weight:
18kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express 1700026L06Rik.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express 1700026L06Rik.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse 1700026L06Rik
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Peptide Sequence:
Synthetic peptide located within the following region: VTNSLLEKCKTLVSQSNDLSSLRAKYPHEVVNHLSCDEARNHYGGVVSLI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-1700026L06Rik (ARP53733_P050) antibody is Catalog # AAP53733
Datasheets/Manuals:
Printable datasheet for anti-1700026L06Rik (ARP53733_P050) antibody
 
X
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...