Now Offering Over 102,157 Antibodies & 44,722 Antigens!

1190002N15Rik Antibody - N-terminal region (ARP55633_P050)

100 ul
In Stock

Conjugation Options

ARP55633_P050-FITC Conjugated

ARP55633_P050-HRP Conjugated

ARP55633_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Protein Name:
Deleted in autism protein 1 homolog
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-99814 from Santa Cruz Biotechnology.
Description of Target:
The function of this protein remains unknown.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express 1190002N15Rik.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express 1190002N15Rik.
The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse 1190002N15Rik
Species Reactivity:
Cow, Dog, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data:
Anti-1190002N15Rik (ARP55633_P050)
Peptide Sequence:
Synthetic peptide located within the following region: FLNVKNVYFAQYGEPREGGRRRVVLKRLGSQRELAQLDQSICKRATGRPR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-1190002N15Rik (ARP55633_P050) antibody is Catalog # AAP55633
Printable datasheet for anti-1190002N15Rik (ARP55633_P050) antibody

Tell us what you think about this item!

Write A Review
    Please, wait...