Now Offering Over 102,157 Antibodies & 44,722 Antigens!

1110067D22Rik antibody - middle region (ARP54991_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock

Conjugation Options

ARP54991_P050-FITC Conjugated

ARP54991_P050-HRP Conjugated

ARP54991_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
Lgalsl
NCBI Gene Id:
216551
Official Gene Full Name:
RIKEN cDNA 1110067D22 gene
Protein Name:
Galectin-related protein A
Swissprot Id:
Q8VED9
Protein Accession #:
NP_776113
Nucleotide Accession #:
NM_173752
Alias Symbols:
Grpa, Hspc159, Lgalsla, A530071M23, RP23-455B19.1, 1110067D22Rik
Description of Target:
1110067D22Rik does not bind lactose, and may not bind carbohydrates.
Protein Size (# AA):
172
Molecular Weight:
19kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express 1110067D22Rik.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express 1110067D22Rik.
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-1110067D22Rik (ARP54991_P050)
Peptide Sequence:
Synthetic peptide located within the following region: CGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Lgalsl (ARP54991_P050) antibody is Catalog # AAP54991 (Previous Catalog # AAPP32252)
Datasheets/Manuals:
Printable datasheet for anti-Lgalsl (ARP54991_P050) antibody

Tell us what you think about this item!

Write A Review
    Please, wait...