Emx1 Antibody - middle region (ARP51624_P050)

Catalog No: ARP51624_P050

WB Suggested Anti-Emx1 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Pancreas

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 82%; Rat: 100%; Zebrafish: 79%
• Peptide Sequence: Synthetic peptide located within the following region: PWVLRNRFFGHRFQASDVPQDGLLLHGPFARKPKRIRTAFSPSQLLRLER
• Concentration: 0.5 mg/ml
• Blocking Peptide: Catalog # AAP51624

Target Info

• Gene Symbol: Emx1
• Gene Full Name: Empty spiracles homolog 1 (Drosophila)
• Alias Symbols: MGC129284, MGC129285
• NCBI Gene Id: 13796
• Protein Name: Homeobox protein EMX1
• Description of Target: Emx1 is a rranscription factor, which in cooperation with EMX2, acts to generate the boundary between the roof and archipallium in the developing brain.It may function in combinations with OTX1/2 to specify cell fates in the developing central nervous system.
• Uniprot ID: Q04742
• Protein Accession #: NP_034261
• Nucleotide Accession #: NM_010131
• Protein Size (# AA): 257
• Molecular Weight: 28kDa
• Protein Interactions: Ccnb1ip1; Id3; Gata6; Kdm4b; Gtf2a1; Gtf2a1l; Irf7; Hnf4g; Spdef; Vdr; Tlx1; Hnf1a; Spi1; Otx2; Meis2; Irf9;