EMX1 Antibody - middle region (ARP47536_P050)

Catalog No: ARP47536_P050

WB Suggested Anti-EMX1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EMX1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 91%
• Peptide Sequence: Synthetic peptide located within the following region: DGLLLHGPFARKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLAGSL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-EMX1 (ARP47536_P050) antibody is Catalog # AAP47536 (Previous Catalog # AAPP28373)
• Reference: Hillier,L.W., (2005) Nature 434 (7034), 724-731

Target Info

• Gene Symbol: EMX1
• Gene Full Name: Empty spiracles homeobox 1
• Alias Symbols: -
• NCBI Gene Id: 2016
• Protein Name: Homeobox protein EMX1
• Description of Target: EMX1 belongs to the EMX homeobox family.It is transcription factor, which in cooperation with EMX2, acts to generate the boundary between the roof and archipallium in the developing brain. The protein may function in combinations with OTX1/2 to specify cell fates in the developing central nervous system.
• Uniprot ID: Q04741
• Protein Accession #: NP_004088
• Nucleotide Accession #: NM_004097
• Protein Size (# AA): 290
• Molecular Weight: 31kDa
• Protein Interactions: ALX4; PRDM4; GTF2A1L; TP63; POLR2D; HOXA10; ELK1;