Size:100 ul
$289.00
In Stock
SKU
ARP75278_P050-FITC
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP75278_P050 Unconjugated

ARP75278_P050-HRP Conjugated

ARP75278_P050-Biotin Conjugated

EMC2 Antibody - N-terminal region : FITC (ARP75278_P050-FITC)

Catalog#: ARP75278_P050-FITC
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC (FAM): Excitation 495 nm/ Emission 520 nm
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human EMC2
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: YDVTWEEMRDKMRKWREENSRNSEQIVEVGEELINEYASKLGDDIWIIYE
Concentration0.5 mg/ml
Blocking PeptideFor anti-EMC2 (ARP75278_P050-FITC) antibody is Catalog # AAP75278
Datasheets/ManualsPrintable datasheet for anti-EMC2 (ARP75278_P050-FITC) antibody
Target ReferenceN/A
Gene SymbolEMC2
Alias SymbolsEMC2, KIAA0103, TTC35,
NCBI Gene Id9694
Description of TargetThe function of this protein remains unknow.
Swissprot IdQ15006
Protein Accession #NP_055488
Protein Size (# AA)297
Molecular Weight32kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express EMC2.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express EMC2.
Write Your Own Review
You're reviewing:EMC2 Antibody - N-terminal region : FITC (ARP75278_P050-FITC)
Your Rating
Aviva Blast Tool
Aviva ChIP Antibodies
Free Microscope
Assay Development