EMB Antibody - C-terminal region (ARP89070_P050)

Catalog No: ARP89070_P050

Host: Rabbit
Target Name: EMB
Sample Tissue: Mouse Pancreas lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse EMB
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: LVAIILLCEVYTHKKKNDPDAGKEFEQIEQLKSDDSNGIENNVPRYRKTD
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-EMB (ARP89070_P050) antibody is Catalog # AAP89070

Target Info

• Gene Symbol: EMB
• Gene Full Name: embigin
• Alias Symbols: Gp7, Gp70, AL022799
• NCBI Gene Id: 13723
• Protein Name: embigin
• Description of Target: Plays a role in targeting the monocarboxylate transporters SLC16A1 and SLC16A7 to the cell membrane (By similarity). Plays a role in the outgrowth of motoneurons and in the formation of neuromuscular junctions. Following muscle denervation, promotes nerve terminal sprouting and the formation of additional acetylcholine receptor clusters at synaptic sites without affecting terminal Schwann cell number or morphology. Delays the retraction of terminal sprouts following re-innervation of denervated endplates.
• Uniprot ID: P21995
• Protein Accession #: NP_034460.3
• Nucleotide Accession #: NM_010330.4
• Protein Size (# AA): 330
• Molecular Weight: 37 kDa