Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP89070_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

EMB Antibody - C-terminal region (ARP89070_P050)

Catalog#: ARP89070_P050
Domestic: within 24 hours delivery | International: 3-5 business days
More Information
Tested Species Reactivity Mouse
Predicted Species Reactivity Mouse
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of mouse EMB
Purification Affinity purified
Peptide Sequence Synthetic peptide located within the following region: LVAIILLCEVYTHKKKNDPDAGKEFEQIEQLKSDDSNGIENNVPRYRKTD
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-EMB (ARP89070_P050) antibody is Catalog # AAP89070
Datasheets/Manuals Printable datasheet for anti-EMB (ARP89070_P050) antibody
Gene Symbol EMB
Official Gene Full Name embigin
Alias Symbols Gp70, AL022799
NCBI Gene Id 13723
Protein Name embigin
Description of Target Plays a role in targeting the monocarboxylate transporters SLC16A1 and SLC16A7 to the cell membrane (By similarity). Plays a role in the outgrowth of motoneurons and in the formation of neuromuscular junctions. Following muscle denervation, promotes nerve terminal sprouting and the formation of additional acetylcholine receptor clusters at synaptic sites without affecting terminal Schwann cell number or morphology. Delays the retraction of terminal sprouts following re-innervation of denervated endplates.
Swissprot Id P21995
Protein Accession # NP_034460.3
Nucleotide Accession # NM_010330.4
Protein Size (# AA) 330
Molecular Weight 37 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express GPR77.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express EMB.
  1. What is the species homology for "EMB Antibody - C-terminal region (ARP89070_P050)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Mouse".

  2. How long will it take to receive "EMB Antibody - C-terminal region (ARP89070_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 business days".

  3. What buffer format is "EMB Antibody - C-terminal region (ARP89070_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "EMB Antibody - C-terminal region (ARP89070_P050)"?

    This target may also be called "Gp70, AL022799" in publications.

  5. What is the shipping cost for "EMB Antibody - C-terminal region (ARP89070_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "EMB Antibody - C-terminal region (ARP89070_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "EMB Antibody - C-terminal region (ARP89070_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "37 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "EMB Antibody - C-terminal region (ARP89070_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "EMB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "EMB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "EMB"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "EMB"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "EMB"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "EMB"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:EMB Antibody - C-terminal region (ARP89070_P050)
Your Rating
We found other products you might like!