Search Antibody, Protein, and ELISA Kit Solutions

EMB Antibody - C-terminal region (ARP89070_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
EMB
Official Gene Full Name:
embigin
NCBI Gene Id:
13723
Protein Name:
embigin
Swissprot Id:
P21995
Protein Accession #:
NP_034460.3
Nucleotide Accession #:
NM_010330.4
Alias Symbols:
Gp70, AL022799
Description of Target:
Plays a role in targeting the monocarboxylate transporters SLC16A1 and SLC16A7 to the cell membrane (By similarity). Plays a role in the outgrowth of motoneurons and in the formation of neuromuscular junctions. Following muscle denervation, promotes nerve terminal sprouting and the formation of additional acetylcholine receptor clusters at synaptic sites without affecting terminal Schwann cell number or morphology. Delays the retraction of terminal sprouts following re-innervation of denervated endplates.
Protein Size (# AA):
330
Molecular Weight:
37 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GPR77.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EMB.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of mouse EMB
Predicted Species Reactivity:
Mouse
Tested Species Reactivity:
Mouse
Peptide Sequence:
Synthetic peptide located within the following region: LVAIILLCEVYTHKKKNDPDAGKEFEQIEQLKSDDSNGIENNVPRYRKTD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-EMB (ARP89070_P050) antibody is Catalog # AAP89070
Datasheets/Manuals:
Printable datasheet for anti-EMB (ARP89070_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...