Catalog No: ARP49667_P050
Price: $0.00
SKU
ARP49667_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ELOVL5 (ARP49667_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ELOVL5
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 92%; Dog: 93%; Goat: 92%; Guinea Pig: 85%; Horse: 79%; Human: 100%; Mouse: 100%; Pig: 92%; Rabbit: 100%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: EHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPK
Concentration0.5 mg/ml
Blocking PeptideFor anti-ELOVL5 (ARP49667_P050) antibody is Catalog # AAP49667 (Previous Catalog # AAPP29250)
Sample Type Confirmation

ELOVL5 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

There is BioGPS gene expression data showing that ELOVL5 is expressed in MCF7

ReferenceBarragan,I., (2005) Int. J. Mol. Med. 16 (6), 1163-1167
Gene SymbolELOVL5
Gene Full NameELOVL fatty acid elongase 5
Alias SymbolsHELO1, SCA38, dJ483K16.1
NCBI Gene Id60481
Protein NameElongation of very long chain fatty acids protein 5
Description of TargetELOVL5 plays a role in elongation of long-chain polyunsaturated fatty acids.ELOVL5 plays a role in elongation of long-chain polyunsaturated fatty acids (Leonard et al., 2000 [PubMed 10970790]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-3003 AF338241.1 9-3011
Uniprot IDQ9NYP7
Protein Accession #NP_068586
Nucleotide Accession #NM_021814
Protein Size (# AA)299
Molecular Weight35kDa
Protein InteractionsUBC; CERS2; ELAVL1;
  1. What is the species homology for "ELOVL5 Antibody - N-terminal region (ARP49667_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit".

  2. How long will it take to receive "ELOVL5 Antibody - N-terminal region (ARP49667_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ELOVL5 Antibody - N-terminal region (ARP49667_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ELOVL5 Antibody - N-terminal region (ARP49667_P050)"?

    This target may also be called "HELO1, SCA38, dJ483K16.1" in publications.

  5. What is the shipping cost for "ELOVL5 Antibody - N-terminal region (ARP49667_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ELOVL5 Antibody - N-terminal region (ARP49667_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ELOVL5 Antibody - N-terminal region (ARP49667_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "35kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ELOVL5 Antibody - N-terminal region (ARP49667_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ELOVL5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ELOVL5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ELOVL5"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ELOVL5"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ELOVL5"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ELOVL5"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ELOVL5 Antibody - N-terminal region (ARP49667_P050)
Your Rating