ELOVL5 Antibody - middle region (ARP90420_P050)

Catalog No: ARP90420_P050

Host: Rabbit
Target Name: ELOVL5
Sample Tissue: Mouse Lung lysates
Antibody Dilution: 1ug/ml

Product Info

• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse ELOVL5
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: VFWPCSFPLGWLFFQIGYMISLIALFTNFYIQTYNKKGASRRKDHLKGHQ
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ELOVL5 (ARP90420_P050) antibody is Catalog # AAP90420

Target Info

• Gene Symbol: ELOVL5
• Gene Full Name: ELOVL family member 5, elongation of long chain fatty acids (yeast)
• Alias Symbols: HELO1, AI747313, AU043003, 1110059L23Rik
• NCBI Gene Id: 68801
• Protein Name: elongation of very long chain fatty acids protein 5
• Description of Target: Catalyzes the first and rate-limiting reaction of the four that constitute the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process, allows the addition of 2 carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cycle. Condensing enzyme that acts specifically toward polyunsaturated acyl-CoA with the higher activity toward C18:3(n-6) acyl-CoA. May participate in the production of monounsaturated and of polyunsaturated VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators.
• Uniprot ID: Q8BHI7
• Protein Accession #: NP_599016.2
• Nucleotide Accession #: NM_134255.3
• Protein Size (# AA): 299
• Molecular Weight: 32 kDa