ELOC Recombinant Protein (Human) (OPCA00236)

Catalog No: OPCA00236

Product Info

• Predicted Species Reactivity: Homo sapiens|Human
• Product Format: Liquid or Lyophilized powder
• Additional Information: Tag information : GST tag
  
• Reconstitution and Storage: -20°C or -80°C
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
• Protein Sequence: MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 1-112 aa
• Tag: N-terminal GST-tagged
• Reference: Structure of the SOCS4-ElonginB/C complex reveals a distinct SOCS box interface and the molecular basis for SOCS-dependent EGFR degradation.Bullock A.N., Rodriguez M.C., Debreczeni J.E., Songyang Z., Knapp S.Structure 15:1493-1504(2007)

Target Info

• Gene Symbol: ELOC
• Gene Full Name: elongin C
• Alias Symbols: elongin 15 kDa subunit;elongin-C;RNA polymerase II transcription factor SIII subunit C;SIII;SIII p15;TCEB1;transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C);transcription elongation factor B polypeptide 1;transcription elongation factor B subunit 1.
• NCBI Gene Id: 6921
• Protein Name: Elongin-C
• Description of Target: SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex) (PubMed:7821821). In embryonic stem cells, the elongin BC complex is recruited by EPOP to Polycomb group (PcG) target genes in order generate genomic region that display both active and repressive chromatin properties, an important feature of pluripotent stem cells (By similarity).
• Uniprot ID: Q15369
• Protein Size (# AA): Recombinant
• Molecular Weight: 39.5 kDa