SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: P100692_T100
Price: $0.00
SKU
P100692_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ELOA (P100692_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityRat, Dog, Guinea Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human TCEB3
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceDog: 100%; Guinea Pig: 91%; Rat: 92%
Peptide SequenceSynthetic peptide located within the following region: AYDGPSTSSAHLAPVVSSTVSYDPRKPTVKKIAPMMAKTIKAFKNRFSRR
Concentration1.0 mg/ml
Blocking PeptideFor anti-ELOA (P100692_T100) antibody is Catalog # AAP31037 (Previous Catalog # AAPP01770)
Sample Type Confirmation

TCEB3 is strongly supported by BioGPS gene expression data to be expressed in HEK293T

ReferenceBeausoleil,S.A., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (33), 12130-12135
Gene SymbolELOA
Gene Full Nameelongin A
Alias SymbolsSIII, TCEB3, TCEB3A, SIII p110
NCBI Gene Id6924
Protein Nameelongin-A
Description of TargetThis gene encodes the protein elongin A, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation.
Uniprot IDQ14241
Protein Accession #NP_003189
Nucleotide Accession #NM_003198
Protein Size (# AA)772
Molecular Weight87kDa
Protein InteractionsKRTAP10-3; CEP57L1; SPERT; FAM9B; KRT40; CEP70; GMCL1; HOMEZ; TRIM54; MID2; PLK4; JAKMIP2; PSMB9; POLR2L; POLR2K; POLR2J; POLR2I; POLR2H; POLR2G; POLR2F; POLR2E; POLR2D; POLR2C; POLR2B; POLR2A; MDFI; UBC; RAD54B; MED26; ECT2; BARD1; CDK12; TCEB2; TCEB1; B
  1. What is the species homology for "ELOA Antibody - C-terminal region (P100692_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Rat, Dog, Guinea Pig".

  2. How long will it take to receive "ELOA Antibody - C-terminal region (P100692_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ELOA Antibody - C-terminal region (P100692_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ELOA Antibody - C-terminal region (P100692_T100)"?

    This target may also be called "SIII, TCEB3, TCEB3A, SIII p110" in publications.

  5. What is the shipping cost for "ELOA Antibody - C-terminal region (P100692_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ELOA Antibody - C-terminal region (P100692_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ELOA Antibody - C-terminal region (P100692_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "87kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ELOA Antibody - C-terminal region (P100692_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ELOA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ELOA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ELOA"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ELOA"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ELOA"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ELOA"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ELOA Antibody - C-terminal region (P100692_T100)
Your Rating