- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Elk3 Antibody (Phospho-Ser357) (OAAF07559)
Datasheets/Manuals | Printable datasheet for Elk3 Antibody (Phospho-Ser357) (OAAF07559) |
---|
Predicted Species Reactivity | Human|Monkey|Mouse |
---|---|
Clonality | Polyclonal |
Host | Rabbit |
Application | Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot |
Additional Information | Modification Sites: Human:S357 Mouse:S359 |
Reconstitution and Storage | -20°C |
Immunogen | The antiserum was produced against synthesized peptide derived from human Elk3 around the phosphorylation site of Ser357. |
Purification | The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide. |
Peptide Sequence | Synthetic peptide located within the following region: SGSLTPAFFTAQTPNGLLLTPSPLLSSIHFWSSLSPVAPLSPARLQGPST |
Concentration | 1mg/ml |
Specificity | Elk3 (Phospho-Ser357) Antibody detects endogenous levels of Elk3 only when phosphorylated at Ser357. |
Formulation | Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. |
Application Info | WB: 1:500~1:1000 IHC: 1:50~1:100 IF: 1:100~1:500 ELISA: 1:20000 |
Gene Symbol | ELK3 |
---|---|
Gene Full Name | ETS transcription factor ELK3 |
Alias Symbols | ELK3, ETS transcription factor;ELK3, ETS-domain protein (SRF accessory protein 2);ERP;ETS domain-containing protein Elk-3;ETS-related protein ERP;ETS-related protein NET;NET;SAP2;SAP-2;serum response factor accessory protein 2;SRF accessory protein 2. |
NCBI Gene Id | 2004 |
Protein Name | ETS domain-containing protein Elk-3 |
Description of Target | May be a negative regulator of transcription, but can activate transcription when coexpressed with Ras, Src or Mos. Forms a ternary complex with the serum response factor and the ETS and SRF motifs of the Fos serum response element. |
Uniprot ID | P41970 |
Molecular Weight | 44 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "Elk3 Antibody (Phospho-Ser357) (OAAF07559)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Monkey|Mouse".
-
How long will it take to receive "Elk3 Antibody (Phospho-Ser357) (OAAF07559)"?
This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".
-
What buffer format is "Elk3 Antibody (Phospho-Ser357) (OAAF07559)" provided in?
This item is provided in "".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "Elk3 Antibody (Phospho-Ser357) (OAAF07559)"?
This target may also be called "ELK3, ETS transcription factor;ELK3, ETS-domain protein (SRF accessory protein 2);ERP;ETS domain-containing protein Elk-3;ETS-related protein ERP;ETS-related protein NET;NET;SAP2;SAP-2;serum response factor accessory protein 2;SRF accessory protein 2." in publications.
-
What is the shipping cost for "Elk3 Antibody (Phospho-Ser357) (OAAF07559)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "Elk3 Antibody (Phospho-Ser357) (OAAF07559)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "Elk3 Antibody (Phospho-Ser357) (OAAF07559)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "44 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "Elk3 Antibody (Phospho-Ser357) (OAAF07559)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "ELK3"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "ELK3"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "ELK3"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "ELK3"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "ELK3"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "ELK3"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.