Elk3 Antibody (Phospho-Ser357) (OAAF07559)

Catalog No: OAAF07559 (Formerly GWB-ASB426)

Size:100 ug

Click here to learn more about Aviva's By-Request Conjugation Service.

Western blot analysis of lysates from COLO205 cells treated with serum 20% 15', using Elk3 (Phospho-Ser357) Antibody. The lane on the right is blocked with the phospho peptide.

Immunohistochemistry analysis of paraffin-embedded human brain, using Elk3 (Phospho-Ser357) Antibody. The picture on the right is blocked with the phospho peptide.

Immunofluorescence analysis of HeLa cells, using Elk3 (Phospho-Ser357) Antibody. The picture on the right is blocked with the phospho peptide.

Product Info

• Predicted Species Reactivity: Human|Monkey|Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Application: Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot
• Additional Information: Modification Sites: Human:S357 Mouse:S359
• Reconstitution and Storage: -20°C
• Immunogen: The antiserum was produced against synthesized peptide derived from human Elk3 around the phosphorylation site of Ser357.
• Purification: The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
• Peptide Sequence: Synthetic peptide located within the following region: SGSLTPAFFTAQTPNGLLLTPSPLLSSIHFWSSLSPVAPLSPARLQGPST
• Concentration: 1mg/ml
• Specificity: Elk3 (Phospho-Ser357) Antibody detects endogenous levels of Elk3 only when phosphorylated at Ser357.
• Formulation: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
• Application Info: WB: 1:500~1:1000
  IHC: 1:50~1:100
  IF: 1:100~1:500
  ELISA: 1:20000

Target Info

• Gene Symbol: ELK3
• Gene Full Name: ETS transcription factor ELK3
• Alias Symbols: ELK3, ETS transcription factor;ELK3, ETS-domain protein (SRF accessory protein 2);ERP;ETS domain-containing protein Elk-3;ETS-related protein ERP;ETS-related protein NET;NET;SAP2;SAP-2;serum response factor accessory protein 2;SRF accessory protein 2.
• NCBI Gene Id: 2004
• Protein Name: ETS domain-containing protein Elk-3
• Description of Target: May be a negative regulator of transcription, but can activate transcription when coexpressed with Ras, Src or Mos. Forms a ternary complex with the serum response factor and the ETS and SRF motifs of the Fos serum response element.
• Uniprot ID: P41970
• Molecular Weight: 44 kDa