Catalog No: P100855_P050-Biotin
Size:100ul
Price: $434.00
SKU
P100855_P050-Biotin
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

ELK3 Antibody - middle region : Biotin (P100855_P050-Biotin)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-ELK3 (P100855_P050-Biotin) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ELK3
Predicted Homology Based on Immunogen SequenceCow: 92%; Dog: 84%; Guinea Pig: 78%; Horse: 78%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%
Peptide SequenceSynthetic peptide located within the following region: RTVIRFVTNKTDKHVTRPVVSLPSTSEAAAASAFLASSVSAKISSLMLPN
Concentration0.5 mg/ml
Blocking PeptideFor anti-ELK3 (P100855_P050-Biotin) antibody is Catalog # AAP31214 (Previous Catalog # AAPP01959)
ReferenceWasylyk,C., (2008) Cancer Res. 68 (5), 1275-1283
Gene SymbolELK3
Gene Full NameELK3, ETS-domain protein (SRF accessory protein 2)
Alias SymbolsERP, NET, SAP2, SAP-2
NCBI Gene Id2004
Protein NameETS domain-containing protein Elk-3
Description of TargetELK3 is a member of the ETS-domain transcription factor family and the ternary complex factor (TCF) subfamily. Proteins in this subfamily regulate transcription when recruited by serum response factor to bind to serum response elements. ELK3 is activated by signal-induced phosphorylation; studies in rodents suggest that it is a transcriptional inhibitor in the absence of Ras, but activates transcription when Ras is present.The protein encoded by this gene is a member of the ETS-domain transcription factor family and the ternary complex factor (TCF) subfamily. Proteins in this subfamily regulate transcription when recruited by serum response factor to bind to serum response elements. This protein is activated by signal-induced phosphorylation; studies in rodents suggest that it is a transcriptional inhibitor in the absence of Ras, but activates transcription when Ras is present. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-619 Z36715.1 1-619 620-2180 BC017371.1 549-2109
Uniprot IDP41970
Protein Accession #NP_005221
Nucleotide Accession #NM_005230
Protein Size (# AA)407
Molecular Weight44kDa
Protein InteractionsAPP; TOP1; UBC; PIAS1; MAPK9; CTBP1; MAPK8; ID2; MAPK14; TCF3;
  1. What is the species homology for "ELK3 Antibody - middle region : Biotin (P100855_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "ELK3 Antibody - middle region : Biotin (P100855_P050-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ELK3 Antibody - middle region : Biotin (P100855_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ELK3 Antibody - middle region : Biotin (P100855_P050-Biotin)"?

    This target may also be called "ERP, NET, SAP2, SAP-2" in publications.

  5. What is the shipping cost for "ELK3 Antibody - middle region : Biotin (P100855_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ELK3 Antibody - middle region : Biotin (P100855_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ELK3 Antibody - middle region : Biotin (P100855_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "44kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ELK3 Antibody - middle region : Biotin (P100855_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ELK3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ELK3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ELK3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ELK3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ELK3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ELK3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ELK3 Antibody - middle region : Biotin (P100855_P050-Biotin)
Your Rating