Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: OAAF07706 (Formerly GWB-ASB658)
Size:100 ug
Price: $344.00
SKU
OAAF07706
Availability: Domestic: within 1-2 week delivery | International: 1-2 weeks
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for Elk1 Antibody (Phospho-Thr417) (OAAF07706)
Product Info
Predicted Species ReactivityHuman|Mouse|Rat
ClonalityPolyclonal
HostRabbit
ApplicationEnzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Immunoprecipitation
Additional InformationModification Sites: Human:T417 Mouse:T418 Rat:T416
Reconstitution and Storage-20°C
ImmunogenThe antiserum was produced against synthesized peptide derived from human Elk1 around the phosphorylation site of Thr417.
PurificationThe antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Peptide SequenceSynthetic peptide located within the following region: WSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVVLSPGPQKP
Concentration1mg/ml
SpecificityElk1 (Phospho-Thr417) Antibody detects endogenous levels of Elk1 only when phosphorylated at Thr417.
FormulationRabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Application Info
IHC: 1:50~1:100
ELISA: 1:10000
Gene SymbolELK1
Gene Full NameETS transcription factor ELK1
Alias SymbolsELK1, ETS transcription factor;ELK1, member of ETS oncogene family;ETS domain-containing protein Elk-1;ETS-like gene 1;tyrosine kinase (ELK1) oncogene.
NCBI Gene Id2002
Protein NameETS domain-containing protein Elk-1
Description of TargetTranscription factor that binds to purine-rich DNA sequences. Forms a ternary complex with SRF and the ETS and SRF motifs of the serum response element (SRE) on the promoter region of immediate early genes such as FOS and IER2. Induces target gene transcription upon JNK-signaling pathway stimulation (By similarity).
Uniprot IDP19419
Molecular Weight44 kDa
  1. What is the species homology for "Elk1 Antibody (Phospho-Thr417) (OAAF07706)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".

  2. How long will it take to receive "Elk1 Antibody (Phospho-Thr417) (OAAF07706)"?

    This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".

  3. What buffer format is "Elk1 Antibody (Phospho-Thr417) (OAAF07706)" provided in?

    This item is provided in "".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Elk1 Antibody (Phospho-Thr417) (OAAF07706)"?

    This target may also be called "ELK1, ETS transcription factor;ELK1, member of ETS oncogene family;ETS domain-containing protein Elk-1;ETS-like gene 1;tyrosine kinase (ELK1) oncogene." in publications.

  5. What is the shipping cost for "Elk1 Antibody (Phospho-Thr417) (OAAF07706)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Elk1 Antibody (Phospho-Thr417) (OAAF07706)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Elk1 Antibody (Phospho-Thr417) (OAAF07706)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "44 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Elk1 Antibody (Phospho-Thr417) (OAAF07706)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ELK1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ELK1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ELK1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ELK1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ELK1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ELK1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Elk1 Antibody (Phospho-Thr417) (OAAF07706)
Your Rating
We found other products you might like!