- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for Elk1 Antibody (Phospho-Thr417) (OAAF07706) |
---|
Predicted Species Reactivity | Human|Mouse|Rat |
---|---|
Clonality | Polyclonal |
Host | Rabbit |
Application | Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Immunoprecipitation |
Additional Information | Modification Sites: Human:T417 Mouse:T418 Rat:T416 |
Reconstitution and Storage | -20°C |
Immunogen | The antiserum was produced against synthesized peptide derived from human Elk1 around the phosphorylation site of Thr417. |
Purification | The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide. |
Peptide Sequence | Synthetic peptide located within the following region: WSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVVLSPGPQKP |
Concentration | 1mg/ml |
Specificity | Elk1 (Phospho-Thr417) Antibody detects endogenous levels of Elk1 only when phosphorylated at Thr417. |
Formulation | Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. |
Application Info | IHC: 1:50~1:100 ELISA: 1:10000 |
Gene Symbol | ELK1 |
---|---|
Gene Full Name | ETS transcription factor ELK1 |
Alias Symbols | ELK1, ETS transcription factor;ELK1, member of ETS oncogene family;ETS domain-containing protein Elk-1;ETS-like gene 1;tyrosine kinase (ELK1) oncogene. |
NCBI Gene Id | 2002 |
Protein Name | ETS domain-containing protein Elk-1 |
Description of Target | Transcription factor that binds to purine-rich DNA sequences. Forms a ternary complex with SRF and the ETS and SRF motifs of the serum response element (SRE) on the promoter region of immediate early genes such as FOS and IER2. Induces target gene transcription upon JNK-signaling pathway stimulation (By similarity). |
Uniprot ID | P19419 |
Molecular Weight | 44 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "Elk1 Antibody (Phospho-Thr417) (OAAF07706)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".
-
How long will it take to receive "Elk1 Antibody (Phospho-Thr417) (OAAF07706)"?
This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".
-
What buffer format is "Elk1 Antibody (Phospho-Thr417) (OAAF07706)" provided in?
This item is provided in "".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "Elk1 Antibody (Phospho-Thr417) (OAAF07706)"?
This target may also be called "ELK1, ETS transcription factor;ELK1, member of ETS oncogene family;ETS domain-containing protein Elk-1;ETS-like gene 1;tyrosine kinase (ELK1) oncogene." in publications.
-
What is the shipping cost for "Elk1 Antibody (Phospho-Thr417) (OAAF07706)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "Elk1 Antibody (Phospho-Thr417) (OAAF07706)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "Elk1 Antibody (Phospho-Thr417) (OAAF07706)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "44 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "Elk1 Antibody (Phospho-Thr417) (OAAF07706)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "ELK1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "ELK1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "ELK1"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "ELK1"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "ELK1"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "ELK1"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.