Search Antibody, Protein, and ELISA Kit Solutions

Elf3 Antibody - N-terminal region (ARP36846_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP36846_P050-FITC Conjugated

ARP36846_P050-HRP Conjugated

ARP36846_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Mouse
Predicted Species Reactivity:
Mouse, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Elf3
Official Gene Full Name:
E74-like factor 3
NCBI Gene Id:
13710
Protein Name:
ETS-related transcription factor Elf-3
Swissprot Id:
Q3UPW2-2
Protein Accession #:
NP_031947
Nucleotide Accession #:
NM_007921
Alias Symbols:
ESE-1, ESX, jen
Replacement Item:
This antibody may replace item sc-133563 from Santa Cruz Biotechnology.
Description of Target:
Elf3 is a transcriptional activator that binds and transactivates ETS sequences containing the consensus nucleotide core sequence GGA[AT]. It acts synergistically with POU2F3 to transactivate the SPRR2A promoter and with RUNX1 to transactivate the ANGPT1 promoter (By similarity). It also transactivates collagenase, CCL20, CLND7, FLG, KRT8, NOS2, PTGS2, SPRR2B, TGFBR2 and TGM3 promoters. IT represses KRT4 promoter activity (By similarity). It may play an important role in epithelial cell differentiation and tumorigenesis and may be a critical downstream effector of the ERBB2 signaling pathway (By similarity). It may be associated with mammary gland development and involution. It plays an important role in the regulation of transcription with TATA-less promoters in preimplantation embryos, which is essential in preimplantation development.
Protein Size (# AA):
371
Molecular Weight:
41kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Elf3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Elf3.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of mouse Elf3
Predicted Homology Based on Immunogen Sequence:
Mouse: 100%; Rat: 93%
Complete computational species homology data:
Anti-Elf3 (ARP36846_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MAATCEISNVFSNYFNAMYSSEDPTLAPAPPTTFGTEDLVLTLNNQQMTL
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Elf3 (ARP36846_P050) antibody is Catalog # AAP36846 (Previous Catalog # AAPP09091)
Datasheets/Manuals:
Printable datasheet for anti-Elf3 (ARP36846_P050) antibody
Target Reference:
Do,H.J., (2006) FEBS Lett. 580 (7), 1865-1871
Publications:

Namiki, T., Valencia, J. C., Hall, M. D. & Hearing, V. J. A novel approach to enhance antibody sensitivity and specificity by peptide cross-linking. Anal. Biochem. 383, 265-9 (2008). IHC, WB, Mouse, Rat 18801330

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...