Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP36846_P050-FITC Conjugated

ARP36846_P050-HRP Conjugated

ARP36846_P050-Biotin Conjugated

Elf3 Antibody - N-terminal region (ARP36846_P050)

Catalog#: ARP36846_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityMouse, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-133563 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of mouse Elf3
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceMouse: 100%; Rat: 93%
Complete computational species homology dataAnti-Elf3 (ARP36846_P050)
Peptide SequenceSynthetic peptide located within the following region: MAATCEISNVFSNYFNAMYSSEDPTLAPAPPTTFGTEDLVLTLNNQQMTL
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-Elf3 (ARP36846_P050) antibody is Catalog # AAP36846 (Previous Catalog # AAPP09091)
Datasheets/ManualsPrintable datasheet for anti-Elf3 (ARP36846_P050) antibody
Target ReferenceDo,H.J., (2006) FEBS Lett. 580 (7), 1865-1871

Namiki, T., Valencia, J. C., Hall, M. D. & Hearing, V. J. A novel approach to enhance antibody sensitivity and specificity by peptide cross-linking. Anal. Biochem. 383, 265-9 (2008). IHC, WB, Mouse, Rat 18801330

Gene SymbolElf3
Official Gene Full NameE74-like factor 3
Alias SymbolsESE-1, ESX, jen
NCBI Gene Id13710
Protein NameETS-related transcription factor Elf-3
Description of TargetElf3 is a transcriptional activator that binds and transactivates ETS sequences containing the consensus nucleotide core sequence GGA[AT]. It acts synergistically with POU2F3 to transactivate the SPRR2A promoter and with RUNX1 to transactivate the ANGPT1 promoter (By similarity). It also transactivates collagenase, CCL20, CLND7, FLG, KRT8, NOS2, PTGS2, SPRR2B, TGFBR2 and TGM3 promoters. IT represses KRT4 promoter activity (By similarity). It may play an important role in epithelial cell differentiation and tumorigenesis and may be a critical downstream effector of the ERBB2 signaling pathway (By similarity). It may be associated with mammary gland development and involution. It plays an important role in the regulation of transcription with TATA-less promoters in preimplantation embryos, which is essential in preimplantation development.
Swissprot IdQ3UPW2-2
Protein Accession #NP_031947
Nucleotide Accession #NM_007921
Protein Size (# AA)371
Molecular Weight41kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express Elf3.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express Elf3.
  1. What is the species homology for "Elf3 Antibody - N-terminal region (ARP36846_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Mouse, Rat".

  2. How long will it take to receive "Elf3 Antibody - N-terminal region (ARP36846_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Elf3 Antibody - N-terminal region (ARP36846_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "Elf3 Antibody - N-terminal region (ARP36846_P050)"?

    This target may also be called "ESE-1, ESX, jen" in publications.

  5. What is the shipping cost for "Elf3 Antibody - N-terminal region (ARP36846_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Elf3 Antibody - N-terminal region (ARP36846_P050)"?

    All Aviva products have been through vigorous validations and carry 100% satisfaction warranty.

  7. Can I get bulk pricing for "Elf3 Antibody - N-terminal region (ARP36846_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "41kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Elf3 Antibody - N-terminal region (ARP36846_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "ELF3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ELF3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ELF3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ELF3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ELF3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ELF3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Elf3 Antibody - N-terminal region (ARP36846_P050)
Your Rating
Aviva Blast Tool
Free Microscope
Aviva Validation Data
Aviva Travel Grant