Search Antibody, Protein, and ELISA Kit Solutions

ELAVL1 Antibody - middle region (ARP97524_P050)

100 ul
In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Predicted Species Reactivity:
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
ELAV like RNA binding protein 1
NCBI Gene Id:
Protein Name:
ELAV-like protein 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
HUR, Hua, MelG, ELAV1
Description of Target:
The protein encoded by this gene is a member of the ELAVL family of RNA-binding proteins that contain several RNA recognition motifs, and selectively bind AU-rich elements (AREs) found in the 3' untranslated regions of mRNAs. AREs signal degradation of mRNAs as a means to regulate gene expression, thus by binding AREs, the ELAVL family of proteins play a role in stabilizing ARE-containing mRNAs. This gene has been implicated in a variety of biological processes and has been linked to a number of diseases, including cancer. It is highly expressed in many cancers, and could be potentially useful in cancer diagnosis, prognosis, and therapy.
Protein Size (# AA):
Molecular Weight:
35 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ELAVL1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ELAVL1.
The immunogen is a synthetic peptide directed towards the middle region of human ELAVL1
Peptide Sequence:
Synthetic peptide located within the following region: DKRSEAEEAITSFNGHKPPGSSEPITVKFAANPNQNKNVALLSQLYHSPA
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-ELAVL1 (ARP97524_P050) antibody is Catalog # AAP97524
Printable datasheet for anti-ELAVL1 (ARP97524_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...