Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP90937_P050
Price: $0.00
SKU
ARP90937_P050
Availability: Domestic: within 24 hours delivery | International: 3-5 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-EIF4G2 (ARP90937_P050) antibody
Product Info
Predicted Species ReactivityMouse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of mouse EIF4G2
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: GQNAQKWIPARSTRRDDNSAANNSANEKERHDAIFRKVRGILNKLTPEKF
Concentration0.5 mg/ml
Blocking PeptideFor anti-EIF4G2 (ARP90937_P050) antibody is Catalog # AAP90937
Gene SymbolEIF4G2
Gene Full Nameeukaryotic translation initiation factor 4, gamma 2
Alias SymbolsNa, DAP, Nat, p97, Nat1, DAP-5, Natm1, E130105L11Rik
NCBI Gene Id13690
Protein Nameeukaryotic translation initiation factor 4 gamma 2
Description of TargetTranslation initiation is mediated by specific recognition of the cap structure by eukaryotic translation initiation factor 4F (eIF4F), which is a cap binding protein complex that consists of three subunits: eIF4A, eIF4E and eIF4G. The protein encoded by this gene shares similarity with the C-terminal region of eIF4G, that contains the binding sites for eIF4A and eIF3; eIF4G in addition, contains a binding site for eIF4E at the N-terminus. Unlike eIF4G which supports cap-dependent and independent translation, this gene product functions as a general repressor of translation by forming translationally inactive complexes. Transgene expression of the apolipoprotein B mRNA-editing enzyme (APOBEC-1) causes extensive editing of this mRNA, which could contribute to the potent oncogenesis induced by overexpression of APOBEC-1. In vitro and in vivo studies in human indicate that translation of this mRNA initiates exclusively at a non-AUG (GUG) codon. This also appears to be true for mouse. Two alternatively spliced transcript variants that encode different isoforms have been found for this gene.
Uniprot IDQ62448
Protein Accession #NP_001035221.1
Nucleotide Accession #NM_001040131.2
Protein Size (# AA)906
Molecular Weight99 kDa
  1. What is the species homology for "EIF4G2 Antibody - N-terminal region (ARP90937_P050)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Mouse".

  2. How long will it take to receive "EIF4G2 Antibody - N-terminal region (ARP90937_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "EIF4G2 Antibody - N-terminal region (ARP90937_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "EIF4G2 Antibody - N-terminal region (ARP90937_P050)"?

    This target may also be called "Na, DAP, Nat, p97, Nat1, DAP-5, Natm1, E130105L11Rik" in publications.

  5. What is the shipping cost for "EIF4G2 Antibody - N-terminal region (ARP90937_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "EIF4G2 Antibody - N-terminal region (ARP90937_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "EIF4G2 Antibody - N-terminal region (ARP90937_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "99 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "EIF4G2 Antibody - N-terminal region (ARP90937_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "EIF4G2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "EIF4G2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "EIF4G2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "EIF4G2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "EIF4G2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "EIF4G2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:EIF4G2 Antibody - N-terminal region (ARP90937_P050)
Your Rating