Search Antibody, Protein, and ELISA Kit Solutions

EIF4E3 Antibody - middle region (ARP41168_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41168_P050-FITC Conjugated

ARP41168_P050-HRP Conjugated

ARP41168_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Eukaryotic translation initiation factor 4E family member 3
NCBI Gene Id:
Protein Name:
Eukaryotic translation initiation factor 4E type 3
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
MGC39820, MGC86971
Replacement Item:
This antibody may replace item sc-133542 from Santa Cruz Biotechnology.
Description of Target:
EIF4E3 belongs to the EIF4E family of translational initiation factors that interact with the 5-prime cap structure of mRNA and recruit mRNA to the ribosome.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EIF4E3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EIF4E3.
The immunogen is a synthetic peptide directed towards the middle region of human EIF4E3
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-EIF4E3 (ARP41168_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VQVWNVNASLVGEATVLEKIYELLPHITFKAVFYKPHEEHHAFEGGRGKH
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-EIF4E3 (ARP41168_P050) antibody is Catalog # AAP41168 (Previous Catalog # AAPP22543)
Printable datasheet for anti-EIF4E3 (ARP41168_P050) antibody

Yi, T., Papadopoulos, E., Hagner, P. R. & Wagner, G. Hypoxia-inducible factor-1-alpha (HIF-1-alpha) promotes cap-dependent translation of selective mRNAs through up-regulating initiation factor eIF4E1 in breast cancer cells under hypoxia conditions. J. Biol. Chem. 288, 18732-42 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 23667251

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...