Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
ARP41168_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41168_P050-FITC Conjugated

ARP41168_P050-HRP Conjugated

ARP41168_P050-Biotin Conjugated

EIF4E3 Antibody - middle region (ARP41168_P050)

Catalog#: ARP41168_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-133542 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human EIF4E3
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology dataAnti-EIF4E3 (ARP41168_P050)
Peptide SequenceSynthetic peptide located within the following region: VQVWNVNASLVGEATVLEKIYELLPHITFKAVFYKPHEEHHAFEGGRGKH
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-EIF4E3 (ARP41168_P050) antibody is Catalog # AAP41168 (Previous Catalog # AAPP22543)
Datasheets/ManualsPrintable datasheet for anti-EIF4E3 (ARP41168_P050) antibody
Publications

Yi, T., Papadopoulos, E., Hagner, P. R. & Wagner, G. Hypoxia-inducible factor-1-alpha (HIF-1-alpha) promotes cap-dependent translation of selective mRNAs through up-regulating initiation factor eIF4E1 in breast cancer cells under hypoxia conditions. J. Biol. Chem. 288, 18732-42 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 23667251

Gene SymbolEIF4E3
Official Gene Full NameEukaryotic translation initiation factor 4E family member 3
Alias SymbolsMGC39820, MGC86971
NCBI Gene Id317649
Protein NameEukaryotic translation initiation factor 4E type 3
Description of TargetEIF4E3 belongs to the EIF4E family of translational initiation factors that interact with the 5-prime cap structure of mRNA and recruit mRNA to the ribosome.
Swissprot IdQ8N5X7
Protein Accession #NP_001128123
Nucleotide Accession #NM_001134649
Protein Size (# AA)224
Molecular Weight24kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express EIF4E3.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express EIF4E3.
Protein InteractionsELAVL1; DCC;
Write Your Own Review
You're reviewing:EIF4E3 Antibody - middle region (ARP41168_P050)
Your Rating
Aviva Validation Data
Aviva Tips and Tricks
Free Microscope
Aviva Blast Tool