Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP48065_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP48065_P050-FITC Conjugated

ARP48065_P050-HRP Conjugated

ARP48065_P050-Biotin Conjugated

EIF4A1 Antibody - middle region (ARP48065_P050)

Catalog#: ARP48065_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-125292 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human EIF4A1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Yeast: 92%; Zebrafish: 100%
Complete computational species homology dataAnti-EIF4A1 (ARP48065_P050)
Peptide SequenceSynthetic peptide located within the following region: TMPSDVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLC
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-EIF4A1 (ARP48065_P050) antibody is Catalog # AAP48065 (Previous Catalog # AAPS21108)
Datasheets/ManualsPrintable datasheet for anti-EIF4A1 (ARP48065_P050) antibody
Sample Type Confirmation

EIF4A1 is strongly supported by BioGPS gene expression data to be expressed in 721_B

Publications

Cap-proximal nucleotides via differential eIF4E binding and alternative promoter usage mediatetranslational response to energy stress. Elife. 6. pii: e21907 (2017). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish 28177284

Gene SymbolEIF4A1
Official Gene Full NameEukaryotic translation initiation factor 4A1
Alias SymbolsDDX2A, EIF-4A, EIF4A, eIF4A-I, eIF-4A-I
NCBI Gene Id1973
Protein NameEukaryotic initiation factor 4A-I
Description of TargetEIF4A1 is an ATP-dependent RNA helicase which is a subunit of the eIF4F complex involved in cap recognition and is required for mRNA binding to ribosome. In the current model of translation initiation, eIF4A unwinds RNA secondary structures in the 5'-UTR of mRNAs which is necessary to allow efficient binding of the small ribosomal subunit, and subsequent scanning for the initiator codon.
Swissprot IdP60842
Protein Accession #NP_001407
Nucleotide Accession #NM_001416
Protein Size (# AA)406
Molecular Weight46
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express EIF4A1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express EIF4A1.
Protein InteractionsHUWE1; UBC; FUS; SUMO2; SUMO3; STAU1; MDM2; SH3RF2; TRAP1; FBXO6; ADRB2; CD81; NPM1; VCAM1; ITGA4; FN1; ESR1; LIG4; RPLP0P6; TMEM43; NDUFB11; ZBTB43; GPRC5A; EIF4G3; EIF4H; VDAC3; UQCRFS1; SDHA; RPS26; RPL19; RPL8; RPSA; ILF2; HSP90AB1; HSPA5; EIF4G2; EIF
  1. What is the species homology for "EIF4A1 Antibody - middle region (ARP48065_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish".

  2. How long will it take to receive "EIF4A1 Antibody - middle region (ARP48065_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "EIF4A1 Antibody - middle region (ARP48065_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "EIF4A1 Antibody - middle region (ARP48065_P050)"?

    This target may also be called "DDX2A, EIF-4A, EIF4A, eIF4A-I, eIF-4A-I" in publications.

  5. What is the shipping cost for "EIF4A1 Antibody - middle region (ARP48065_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "EIF4A1 Antibody - middle region (ARP48065_P050)"?

    All Aviva products have been through vigorous validations and carry 100% satisfaction warranty.

  7. Can I get bulk pricing for "EIF4A1 Antibody - middle region (ARP48065_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "46".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "EIF4A1 Antibody - middle region (ARP48065_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "EIF4A1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "EIF4A1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "EIF4A1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "EIF4A1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "EIF4A1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "EIF4A1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:EIF4A1 Antibody - middle region (ARP48065_P050)
Your Rating
Aviva Blast Tool
Aviva Travel Grant
Free Microscope
Aviva Pathways