Search Antibody, Protein, and ELISA Kit Solutions

EIF4A1 antibody - middle region (ARP48065_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP48065_P050-FITC Conjugated

ARP48065_P050-HRP Conjugated

ARP48065_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Eukaryotic translation initiation factor 4A1
Protein Name:
Eukaryotic initiation factor 4A-I
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-125292 from Santa Cruz Biotechnology.
Description of Target:
EIF4A1 is an ATP-dependent RNA helicase which is a subunit of the eIF4F complex involved in cap recognition and is required for mRNA binding to ribosome. In the current model of translation initiation, eIF4A unwinds RNA secondary structures in the 5'-UTR of mRNAs which is necessary to allow efficient binding of the small ribosomal subunit, and subsequent scanning for the initiator codon.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EIF4A1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EIF4A1.
The immunogen is a synthetic peptide directed towards the middle region of human EIF4A1
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Yeast: 92%; Zebrafish: 100%
Complete computational species homology data:
Anti-EIF4A1 (ARP48065_P050)
Peptide Sequence:
Synthetic peptide located within the following region: TMPSDVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLC
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-EIF4A1 (ARP48065_P050) antibody is Catalog # AAP48065 (Previous Catalog # AAPS21108)
Printable datasheet for anti-EIF4A1 (ARP48065_P050) antibody
Sample Type Confirmation:

EIF4A1 is strongly supported by BioGPS gene expression data to be expressed in 721_B


Cap-proximal nucleotides via differential eIF4E binding and alternative promoter usage mediatetranslational response to energy stress.Elife. 2017 Feb 8;6. pii: e21907. WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish 28177284

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...