Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP48065_P050-FITC Conjugated

ARP48065_P050-HRP Conjugated

ARP48065_P050-Biotin Conjugated

EIF4A1 Antibody - middle region (ARP48065_P050)

Catalog#: ARP48065_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-125292 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human EIF4A1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Yeast: 92%; Zebrafish: 100%
Complete computational species homology data Anti-EIF4A1 (ARP48065_P050)
Peptide Sequence Synthetic peptide located within the following region: TMPSDVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLC
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-EIF4A1 (ARP48065_P050) antibody is Catalog # AAP48065 (Previous Catalog # AAPS21108)
Datasheets/Manuals Printable datasheet for anti-EIF4A1 (ARP48065_P050) antibody
Sample Type Confirmation

EIF4A1 is strongly supported by BioGPS gene expression data to be expressed in 721_B


Cap-proximal nucleotides via differential eIF4E binding and alternative promoter usage mediatetranslational response to energy stress. Elife. 6. pii: e21907 (2017). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish 28177284

Gene Symbol EIF4A1
Official Gene Full Name Eukaryotic translation initiation factor 4A1
Alias Symbols DDX2A, EIF-4A, EIF4A, eIF4A-I, eIF-4A-I
NCBI Gene Id 1973
Protein Name Eukaryotic initiation factor 4A-I
Description of Target EIF4A1 is an ATP-dependent RNA helicase which is a subunit of the eIF4F complex involved in cap recognition and is required for mRNA binding to ribosome. In the current model of translation initiation, eIF4A unwinds RNA secondary structures in the 5'-UTR of mRNAs which is necessary to allow efficient binding of the small ribosomal subunit, and subsequent scanning for the initiator codon.
Swissprot Id P60842
Protein Accession # NP_001407
Nucleotide Accession # NM_001416
Protein Size (# AA) 406
Molecular Weight 46
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express EIF4A1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express EIF4A1.
  1. What is the species homology for "EIF4A1 Antibody - middle region (ARP48065_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish".

  2. How long will it take to receive "EIF4A1 Antibody - middle region (ARP48065_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "EIF4A1 Antibody - middle region (ARP48065_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "EIF4A1 Antibody - middle region (ARP48065_P050)"?

    This target may also be called "DDX2A, EIF-4A, EIF4A, eIF4A-I, eIF-4A-I" in publications.

  5. What is the shipping cost for "EIF4A1 Antibody - middle region (ARP48065_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "EIF4A1 Antibody - middle region (ARP48065_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "EIF4A1 Antibody - middle region (ARP48065_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "46".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "EIF4A1 Antibody - middle region (ARP48065_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "EIF4A1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "EIF4A1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "EIF4A1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "EIF4A1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "EIF4A1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "EIF4A1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:EIF4A1 Antibody - middle region (ARP48065_P050)
Your Rating
We found other products you might like!