SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP61945_P050-FITC
Size:100ul
Price: $434.00
SKU
ARP61945_P050-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

Eif4a1 Antibody - C-terminal region : FITC (ARP61945_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-Eif4a1 (ARP61945_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Peptide SequenceSynthetic peptide located within the following region: AVIFINTRRKVDWLTEKMHARDFTVSAMHGDMDQKERDVIMREFRSGSSR
Concentration0.5 mg/ml
Blocking PeptideFor anti-Eif4a1 (ARP61945_P050-FITC) antibody is Catalog # AAP61945
Gene SymbolEif4a1
Gene Full NameEukaryotic translation initiation factor 4A1
Alias SymbolsEif, Eif4, Ddx2a, BM-010
NCBI Gene Id13681
Protein NameEukaryotic initiation factor 4A-I
Description of TargetEif4a1 is a ATP-dependent RNA helicase which is a subunit of the eIF4F complex involved in cap recognition and is required for mRNA binding to ribosome. In the current model of translation initiation, eIF4A unwinds RNA secondary structures in the 5'-UTR of mRNAs which is necessary to allow efficient binding of the small ribosomal subunit, and subsequent scanning for the initiator codon.
Uniprot IDP60843
Protein Accession #NP_659207
Nucleotide Accession #NM_144958
Protein Size (# AA)406
Molecular Weight46kDa
Protein InteractionsEed; UBQLN1; SQSTM1; RAD23B; Fbxo32; Tcf3;
  1. What is the species homology for "Eif4a1 Antibody - C-terminal region : FITC (ARP61945_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "Eif4a1 Antibody - C-terminal region : FITC (ARP61945_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Eif4a1 Antibody - C-terminal region : FITC (ARP61945_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Eif4a1 Antibody - C-terminal region : FITC (ARP61945_P050-FITC)"?

    This target may also be called "Eif, Eif4, Ddx2a, BM-010" in publications.

  5. What is the shipping cost for "Eif4a1 Antibody - C-terminal region : FITC (ARP61945_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Eif4a1 Antibody - C-terminal region : FITC (ARP61945_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Eif4a1 Antibody - C-terminal region : FITC (ARP61945_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "46kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Eif4a1 Antibody - C-terminal region : FITC (ARP61945_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "EIF4A1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "EIF4A1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "EIF4A1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "EIF4A1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "EIF4A1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "EIF4A1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Eif4a1 Antibody - C-terminal region : FITC (ARP61945_P050-FITC)
Your Rating
We found other products you might like!