SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP48293_T100-HRP
Size:100ul
Price: $384.00
SKU
ARP48293_T100-HRP
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

EIF3M Antibody - N-terminal region : HRP (ARP48293_T100-HRP)

Datasheets/ManualsPrintable datasheet for anti-EIF3M (ARP48293_T100-HRP) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationIHC, WB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human EIF3M
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Peptide SequenceSynthetic peptide located within the following region: MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACD
Concentration0.5 mg/ml
Blocking PeptideFor anti-EIF3M (ARP48293_T100-HRP) antibody is Catalog # AAP48293 (Previous Catalog # AAPY01662)
Sample Type Confirmation

There is BioGPS gene expression data showing that EIF3M is expressed in HepG2

SubunitM
ReferenceKobayashi,K., Brain Res. 1170, 129-139 (2007)
Publications

Cheshenko, N., Trepanier, J. B., Segarra, T. J., Fuller, A. O. & Herold, B. C. HSV usurps eukaryotic initiation factor 3 subunit M for viral protein translation: novel prevention target. PLoS One 5, e11829 (2010). WB, IHC, ICC/IF, Human, Rat, Dog, Bovine, Pig, Rabbit, Guinea pig, Horse, Mouse, Zebrafish 20676407

Gene SymbolEIF3M
Gene Full NameEukaryotic translation initiation factor 3, subunit M
Alias SymbolsB5, GA17, PCID1, TANGO7, hfl-B5
NCBI Gene Id10480
Protein NameEukaryotic translation initiation factor 3 subunit M
Description of TargetEIF3M is a broadly expressed protein containing putative membrane fusion domains that acts as a receptor or coreceptor for entry of herpes simplex virus (HSV).HFLB5 encodes a broadly expressed protein containing putative membrane fusion domains that acts as a receptor or coreceptor for entry of herpes simplex virus (HSV) (Perez et al., 2005 [PubMed 15919898]).[supplied by OMIM].
Uniprot IDQ7L2H7
Protein Accession #NP_006351
Nucleotide Accession #NM_006360
Protein Size (# AA)374
Molecular Weight42kDa
Protein InteractionsHUWE1; FAM96B; UBC; SUMO2; rev; SRPK1; EXOSC10; NPM1; MMS19; gag-pol; EIF3D; EIF3F; EIF3L; EIF3K; EIF3I; EIF3H; EIF3G; EIF3C; EIF3B; EIF3A; EIF3E; APP; TADA2A; EIF1B; EIF4A2;
  1. What is the species homology for "EIF3M Antibody - N-terminal region : HRP (ARP48293_T100-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "EIF3M Antibody - N-terminal region : HRP (ARP48293_T100-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "EIF3M Antibody - N-terminal region : HRP (ARP48293_T100-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "EIF3M Antibody - N-terminal region : HRP (ARP48293_T100-HRP)"?

    This target may also be called "B5, GA17, PCID1, TANGO7, hfl-B5" in publications.

  5. What is the shipping cost for "EIF3M Antibody - N-terminal region : HRP (ARP48293_T100-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "EIF3M Antibody - N-terminal region : HRP (ARP48293_T100-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "EIF3M Antibody - N-terminal region : HRP (ARP48293_T100-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "42kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "EIF3M Antibody - N-terminal region : HRP (ARP48293_T100-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "EIF3M"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "EIF3M"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "EIF3M"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "EIF3M"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "EIF3M"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "EIF3M"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:EIF3M Antibody - N-terminal region : HRP (ARP48293_T100-HRP)
Your Rating
We found other products you might like!