Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

EIF3M antibody - N-terminal region (ARP48293_T100)

100 ul
$249.00
In Stock

Conjugation Options

ARP48293_T100-FITC Conjugated

ARP48293_T100-HRP Conjugated

ARP48293_T100-Biotin Conjugated

Gene Symbol:
EIF3M
NCBI Gene Id:
10480
Official Gene Full Name:
Eukaryotic translation initiation factor 3, subunit M
Protein Name:
Eukaryotic translation initiation factor 3 subunit M
Swissprot Id:
Q7L2H7
Protein Accession #:
NP_006351
Nucleotide Accession #:
NM_006360
Alias Symbols:
B5, FLJ29030, GA17, PCID1, hfl-B5
Replacement Item:
This antibody may replace item sc-133541 from Santa Cruz Biotechnology.
Description of Target:
EIF3M is a broadly expressed protein containing putative membrane fusion domains that acts as a receptor or coreceptor for entry of herpes simplex virus (HSV).HFLB5 encodes a broadly expressed protein containing putative membrane fusion domains that acts as a receptor or coreceptor for entry of herpes simplex virus (HSV) (Perez et al., 2005 [PubMed 15919898]).[supplied by OMIM].
Protein Size (# AA):
374
Molecular Weight:
42kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EIF3M.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EIF3M.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human EIF3M
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-EIF3M (ARP48293_T100)
Peptide Sequence:
Synthetic peptide located within the following region: MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
HUWE1; FAM96B; UBC; SUMO2; rev; SRPK1; EXOSC10; NPM1; MMS19; gag-pol; EIF3D; EIF3F; EIF3L; EIF3K; EIF3I; EIF3H; EIF3G; EIF3C; EIF3B; EIF3A; EIF3E; APP; TADA2A; EIF1B; EIF4A2;
Blocking Peptide:
For anti-EIF3M (ARP48293_T100) antibody is Catalog # AAP48293 (Previous Catalog # AAPY01662)
Datasheets/Manuals:
Printable datasheet for anti-EIF3M (ARP48293_T100) antibody
Sample Type Confirmation:

There is BioGPS gene expression data showing that EIF3M is expressed in HepG2

Subunit:
M
Target Reference:
Kobayashi,K., Brain Res. 1170, 129-139 (2007)
Publications:

Cheshenko, N., Trepanier, J. B., Segarra, T. J., Fuller, A. O. & Herold, B. C. HSV usurps eukaryotic initiation factor 3 subunit M for viral protein translation: novel prevention target. PLoS One 5, e11829 (2010). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 20676407

Tell us what you think about this item!

Write A Review
    Please, wait...