Search Antibody, Protein, and ELISA Kit Solutions

EIF3M Antibody - N-terminal region (ARP48293_T100)

100 ul

Regular Price: $249.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP48293_T100-FITC Conjugated

ARP48293_T100-HRP Conjugated

ARP48293_T100-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-133541 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the N terminal region of human EIF3M
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-EIF3M (ARP48293_T100)
Peptide Sequence:
Synthetic peptide located within the following region: MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACD
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-EIF3M (ARP48293_T100) antibody is Catalog # AAP48293 (Previous Catalog # AAPY01662)
Printable datasheet for anti-EIF3M (ARP48293_T100) antibody
Sample Type Confirmation:

There is BioGPS gene expression data showing that EIF3M is expressed in HepG2

Target Reference:
Kobayashi,K., Brain Res. 1170, 129-139 (2007)

Cheshenko, N., Trepanier, J. B., Segarra, T. J., Fuller, A. O. & Herold, B. C. HSV usurps eukaryotic initiation factor 3 subunit M for viral protein translation: novel prevention target. PLoS One 5, e11829 (2010). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 20676407

Gene Symbol:
Official Gene Full Name:
Eukaryotic translation initiation factor 3, subunit M
Alias Symbols:
B5, FLJ29030, GA17, PCID1, hfl-B5
NCBI Gene Id:
Protein Name:
Eukaryotic translation initiation factor 3 subunit M
Description of Target:
EIF3M is a broadly expressed protein containing putative membrane fusion domains that acts as a receptor or coreceptor for entry of herpes simplex virus (HSV).HFLB5 encodes a broadly expressed protein containing putative membrane fusion domains that acts as a receptor or coreceptor for entry of herpes simplex virus (HSV) (Perez et al., 2005 [PubMed 15919898]).[supplied by OMIM].
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EIF3M.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EIF3M.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...