Size:100 ul
Special Price $229.00 Regular Price $249.00
In Stock
SKU
ARP48293_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP48293_T100-FITC Conjugated

ARP48293_T100-HRP Conjugated

ARP48293_T100-Biotin Conjugated

EIF3M Antibody - N-terminal region (ARP48293_T100)

Catalog#: ARP48293_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-133541 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human EIF3M
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data Anti-EIF3M (ARP48293_T100)
Peptide Sequence Synthetic peptide located within the following region: MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACD
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-EIF3M (ARP48293_T100) antibody is Catalog # AAP48293 (Previous Catalog # AAPY01662)
Datasheets/Manuals Printable datasheet for anti-EIF3M (ARP48293_T100) antibody
Sample Type Confirmation

There is BioGPS gene expression data showing that EIF3M is expressed in HepG2

Subunit M
Target Reference Kobayashi,K., Brain Res. 1170, 129-139 (2007)
Publications

Cheshenko, N., Trepanier, J. B., Segarra, T. J., Fuller, A. O. & Herold, B. C. HSV usurps eukaryotic initiation factor 3 subunit M for viral protein translation: novel prevention target. PLoS One 5, e11829 (2010). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 20676407

Gene Symbol EIF3M
Official Gene Full Name Eukaryotic translation initiation factor 3, subunit M
Alias Symbols B5, FLJ29030, GA17, PCID1, hfl-B5
NCBI Gene Id 10480
Protein Name Eukaryotic translation initiation factor 3 subunit M
Description of Target EIF3M is a broadly expressed protein containing putative membrane fusion domains that acts as a receptor or coreceptor for entry of herpes simplex virus (HSV).HFLB5 encodes a broadly expressed protein containing putative membrane fusion domains that acts as a receptor or coreceptor for entry of herpes simplex virus (HSV) (Perez et al., 2005 [PubMed 15919898]).[supplied by OMIM].
Swissprot Id Q7L2H7
Protein Accession # NP_006351
Nucleotide Accession # NM_006360
Protein Size (# AA) 374
Molecular Weight 42kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express EIF3M.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express EIF3M.
Protein Interactions HUWE1; FAM96B; UBC; SUMO2; rev; SRPK1; EXOSC10; NPM1; MMS19; gag-pol; EIF3D; EIF3F; EIF3L; EIF3K; EIF3I; EIF3H; EIF3G; EIF3C; EIF3B; EIF3A; EIF3E; APP; TADA2A; EIF1B; EIF4A2;
  1. What is the species homology for "EIF3M Antibody - N-terminal region (ARP48293_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "EIF3M Antibody - N-terminal region (ARP48293_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "EIF3M Antibody - N-terminal region (ARP48293_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "EIF3M Antibody - N-terminal region (ARP48293_T100)"?

    This target may also be called "B5, FLJ29030, GA17, PCID1, hfl-B5" in publications.

  5. What is the shipping cost for "EIF3M Antibody - N-terminal region (ARP48293_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "EIF3M Antibody - N-terminal region (ARP48293_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "EIF3M Antibody - N-terminal region (ARP48293_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "42kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "EIF3M Antibody - N-terminal region (ARP48293_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "EIF3M"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "EIF3M"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "EIF3M"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "EIF3M"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "EIF3M"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "EIF3M"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:EIF3M Antibody - N-terminal region (ARP48293_T100)
Your Rating