Catalog No: ARP48293_T100
Price: $0.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-EIF3M (ARP48293_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human EIF3M
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Peptide SequenceSynthetic peptide located within the following region: MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACD
Concentration1.0 mg/ml
Blocking PeptideFor anti-EIF3M (ARP48293_T100) antibody is Catalog # AAP48293 (Previous Catalog # AAPY01662)
Sample Type Confirmation

There is BioGPS gene expression data showing that EIF3M is expressed in HepG2

ReferenceKobayashi,K., Brain Res. 1170, 129-139 (2007)

Cheshenko, N., Trepanier, J. B., Segarra, T. J., Fuller, A. O. & Herold, B. C. HSV usurps eukaryotic initiation factor 3 subunit M for viral protein translation: novel prevention target. PLoS One 5, e11829 (2010). 20676407

Gene SymbolEIF3M
Gene Full NameEukaryotic translation initiation factor 3, subunit M
Alias SymbolsB5, GA17, PCID1, TANGO7, hfl-B5
NCBI Gene Id10480
Protein NameEukaryotic translation initiation factor 3 subunit M
Description of TargetEIF3M is a broadly expressed protein containing putative membrane fusion domains that acts as a receptor or coreceptor for entry of herpes simplex virus (HSV).HFLB5 encodes a broadly expressed protein containing putative membrane fusion domains that acts as a receptor or coreceptor for entry of herpes simplex virus (HSV) (Perez et al., 2005 [PubMed 15919898]).[supplied by OMIM].
Uniprot IDQ7L2H7
Protein Accession #NP_006351
Nucleotide Accession #NM_006360
Protein Size (# AA)374
Molecular Weight43 kDa
Protein InteractionsHUWE1; FAM96B; UBC; SUMO2; rev; SRPK1; EXOSC10; NPM1; MMS19; gag-pol; EIF3D; EIF3F; EIF3L; EIF3K; EIF3I; EIF3H; EIF3G; EIF3C; EIF3B; EIF3A; EIF3E; APP; TADA2A; EIF1B; EIF4A2;
  1. What is the species homology for "EIF3M Antibody - N-terminal region (ARP48293_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "EIF3M Antibody - N-terminal region (ARP48293_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "EIF3M Antibody - N-terminal region (ARP48293_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "EIF3M Antibody - N-terminal region (ARP48293_T100)"?

    This target may also be called "B5, GA17, PCID1, TANGO7, hfl-B5" in publications.

  5. What is the shipping cost for "EIF3M Antibody - N-terminal region (ARP48293_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "EIF3M Antibody - N-terminal region (ARP48293_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "EIF3M Antibody - N-terminal region (ARP48293_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "43 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "EIF3M Antibody - N-terminal region (ARP48293_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "EIF3M"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "EIF3M"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "EIF3M"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "EIF3M"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "EIF3M"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "EIF3M"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:EIF3M Antibody - N-terminal region (ARP48293_T100)
Your Rating