Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

EIF3M Antibody - N-terminal region (ARP48293_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP48293_T100-FITC Conjugated

ARP48293_T100-HRP Conjugated

ARP48293_T100-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Eukaryotic translation initiation factor 3, subunit M
NCBI Gene Id:
Protein Name:
Eukaryotic translation initiation factor 3 subunit M
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
B5, FLJ29030, GA17, PCID1, hfl-B5
Replacement Item:
This antibody may replace item sc-133541 from Santa Cruz Biotechnology.
Description of Target:
EIF3M is a broadly expressed protein containing putative membrane fusion domains that acts as a receptor or coreceptor for entry of herpes simplex virus (HSV).HFLB5 encodes a broadly expressed protein containing putative membrane fusion domains that acts as a receptor or coreceptor for entry of herpes simplex virus (HSV) (Perez et al., 2005 [PubMed 15919898]).[supplied by OMIM].
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EIF3M.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EIF3M.
The immunogen is a synthetic peptide directed towards the N terminal region of human EIF3M
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-EIF3M (ARP48293_T100)
Peptide Sequence:
Synthetic peptide located within the following region: MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-EIF3M (ARP48293_T100) antibody is Catalog # AAP48293 (Previous Catalog # AAPY01662)
Printable datasheet for anti-EIF3M (ARP48293_T100) antibody
Sample Type Confirmation:

There is BioGPS gene expression data showing that EIF3M is expressed in HepG2

Target Reference:
Kobayashi,K., Brain Res. 1170, 129-139 (2007)

Cheshenko, N., Trepanier, J. B., Segarra, T. J., Fuller, A. O. & Herold, B. C. HSV usurps eukaryotic initiation factor 3 subunit M for viral protein translation: novel prevention target. PLoS One 5, e11829 (2010). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 20676407

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...