EIF3G Antibody - middle region (ARP40485_P050)

Catalog No: ARP40485_P050

WB Suggested Anti-EIF3G Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate

Host: Rabbit
Target Name: EIF3G
Sample Type: MCF7
Antibody Dilution: 1.0ug/mlEIF3G is supported by BioGPS gene expression data to be expressed in MCF7

Host: Rabbit
Target Name: EIF3G
Sample Type: 293T
Antibody Dilution: 1.0ug/mlEIF3G is supported by BioGPS gene expression data to be expressed in HEK293T

Sample Type:
Human brain stem cells
Primary Antibody Dilution:
1:500
Secondary Antibody:
Goat anti-rabbit Alexa-Fluor 594
Secondary Antibody Dilution:
1:1000
Color/Signal Descriptions:
EIF3G: Red DAPI:Blue
Gene Name:
EIF3G
Submitted by:
Dr. Yuzhi Chen, University of Arkansas for Medical Science

Amount and Sample Type:
500 ug mouse brain homogenate
Amount of IP Antibody:
6 ug
Primary Antibody:
EIF3G
Primary Antibody Dilution:
1:500
Secondary Antibody:
Goat anti-rabbit Alexa-Fluor 594
Secondary Antibody Dilution:
1:5000
Gene Name:
EIF3G
Submitted by:
Dr. Yuzhi Chen, University of Arkansas for Medical Science

Product Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, IP, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EIF3G
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: LRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISR
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-EIF3G (ARP40485_P050) antibody is Catalog # AAP40485 (Previous Catalog # AAPS03112)
• Sample Type Confirmation:

  EIF3G is supported by BioGPS gene expression data to be expressed in HEK293T, MCF7

• Subunit: G
• Other Applications Image 1 Data: IP Suggested Anti-EIF3G Antibody
  Positive Control: NT2 CELL/BRAIN TISSUE
  
• Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)
• Other Applications Image 2 Data: IP Suggested Anti-EIF3G antibody
  Titration: 2 ug/ml
  Positive Control: Mouse brain homogenate
  

Target Info

• Gene Symbol: EIF3G
• Gene Full Name: Eukaryotic translation initiation factor 3, subunit G
• Alias Symbols: EIF3S4, EIF3-P42, eIF3-p44, eIF3-delta
• NCBI Gene Id: 8666
• Protein Name: Eukaryotic translation initiation factor 3 subunit G
• Description of Target: EIF3G belongs to the eIF-3 subunit G family. It is a component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis.
• Uniprot ID: O75821
• Protein Accession #: NP_003746
• Nucleotide Accession #: NM_003755
• Protein Size (# AA): 320
• Molecular Weight: 35kDa
• Protein Interactions: FAM9B; GOLGA2; SUMO2; EIF3I; NCL; DYNC1I2; EIF3B; EIF3C; NPM1; ICAM1; CD81; IGSF8; PAN2; EIF3D; DDX3X; gag-pol; EIF3L; EIF3K; EIF3M; EIF3H; EIF3F; EIF3A; EIF3E; APP; CUL3; ACD; POT1; YWHAZ; UBC; GADD45G; TK1; SNCA; SMN1; PKN2; PIN1; Itsn2; USP3; MPHOSPH6;