Catalog No: OPCA260798
Price: $0.00
SKU
OPCA260798
Availability: Domestic: within 4-8 weeks delivery International: 4-8 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Protein on Demand™ EIF2B1 Recombinant Protein (Rat) (OPCA260798)
Datasheets/Manuals | Printable datasheet for OPCA260798 |
---|
Predicted Species Reactivity | Rat |
---|---|
Product Format | Liquid |
Application | WB, ELISA |
Reconstitution and Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Protein Sequence | MEDGELIKYFKSQMKGDPNMASAVAAIQTLLEFLKRDKGETIQGLRAHLTKAIETLCAVDSSVAVSSGGELFLRFISLTSLEYSDYSKCKKIMIERGELFLSRISLSRTKIASLCHAFIKDGARILTHAYSRVVLRVLEEAVAAKKRFSVYITESQPDLSGKKMAKALCHLNVPVTVVLDAAVGYIMEKVDLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYKADTLKSVQAGQDLKEEHPWVDYTSPSLITLLFTDLGVLTPSAVSDELIKLYL |
Storage Buffer | Tris-based buffer,50% glycerol |
Protein Range | 1-305 |
Gene Full Name | eukaryotic translation initiation factor 2B subunit alpha |
---|---|
Alias Symbols | eIF-2a |
NCBI Gene Id | 64514 |
Protein Name | translation initiation factor eIF-2B subunit alpha |
Description of Target | alpha subunit of eukaryotic peptide initiation factor 2B involved with mRNA translation into protein; may regulate protein synthesis when peptide chain initiation is inhibited [RGD, Feb 2006] |
Uniprot ID | Q64270 |
Protein Size (# AA) | 305 |
Write Your Own Review