Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP36709_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP36709_P050-FITC Conjugated

ARP36709_P050-HRP Conjugated

ARP36709_P050-Biotin Conjugated

EIF2AK2 Antibody - middle region (ARP36709_P050)

Rating:
80% of 100
Catalog#: ARP36709_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-100378 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human EIF2AK2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 92%; Dog: 83%; Horse: 91%; Human: 100%; Mouse: 83%; Pig: 83%; Rabbit: 100%; Rat: 92%
Complete computational species homology dataAnti-EIF2AK2 (ARP36709_P050)
Peptide SequenceSynthetic peptide located within the following region: QVFKAKHRIDGKTYVIKRVKYNNEKAEREVKALAKLDHVNIVHYNGCWDG
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-EIF2AK2 (ARP36709_P050) antibody is Catalog # AAP36709 (Previous Catalog # AAPP08602)
Datasheets/ManualsPrintable datasheet for anti-EIF2AK2 (ARP36709_P050) antibody
Sample Type Confirmation

EIF2AK2 is strongly supported by BioGPS gene expression data to be expressed in HeLa

Gene SymbolEIF2AK2
Official Gene Full NameEukaryotic translation initiation factor 2-alpha kinase 2
Alias SymbolsEIF2AK1, MGC126524, PKR, PRKR
NCBI Gene Id5610
Protein NameInterferon-induced, double-stranded RNA-activated protein kinase
Description of TargetEIF2AK2 might play a role in ER stress-induced apoptosis and in Alzheimer's disease. Alzheimer cases show prominent EIF2AK2 activation in association with neuritic plaques and pyramidal neurons in the hippocampus and neocortex.
Swissprot IdP19525
Protein Accession #NP_002750
Nucleotide Accession #NM_002759
Protein Size (# AA)551
Molecular Weight62kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express EIF2AK2.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express EIF2AK2.
Protein InteractionsUBC; TRAF6; TRAF5; TRAF2; EGFR; DHX9; STAU2; PRKRA; EIF2AK2; HECW2; TOP1; STAU1; DICER1; DHX30; EBNA1BP2; IGF2BP2; IGF2BP3; PABPC4; MOV10; ILF3; ILF2; HSP90AA1; EIF2A; NOC3L; GNL3; NOP2; HNRNPC; HIST1H1C; ELAVL1; NPM1; IL7R; gag; Jak2; TYK2; JAK1; EIF2S1;
Write Your Own Review
You're reviewing:EIF2AK2 Antibody - middle region (ARP36709_P050)
Your Rating
Aviva Tissue Tool
Aviva Blast Tool
Aviva Tips and Tricks
Aviva Pathways