Search Antibody, Protein, and ELISA Kit Solutions

EIF2AK2 Antibody - middle region (ARP36709_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP36709_P050-FITC Conjugated

ARP36709_P050-HRP Conjugated

ARP36709_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
EIF2AK2
Official Gene Full Name:
Eukaryotic translation initiation factor 2-alpha kinase 2
NCBI Gene Id:
5610
Protein Name:
Interferon-induced, double-stranded RNA-activated protein kinase
Swissprot Id:
P19525
Protein Accession #:
NP_002750
Nucleotide Accession #:
NM_002759
Alias Symbols:
EIF2AK1, MGC126524, PKR, PRKR
Replacement Item:
This antibody may replace item sc-100378 from Santa Cruz Biotechnology.
Description of Target:
EIF2AK2 might play a role in ER stress-induced apoptosis and in Alzheimer's disease. Alzheimer cases show prominent EIF2AK2 activation in association with neuritic plaques and pyramidal neurons in the hippocampus and neocortex.
Protein Size (# AA):
551
Molecular Weight:
62kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EIF2AK2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EIF2AK2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human EIF2AK2
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 83%; Horse: 91%; Human: 100%; Mouse: 83%; Pig: 83%; Rabbit: 100%; Rat: 92%
Complete computational species homology data:
Anti-EIF2AK2 (ARP36709_P050)
Peptide Sequence:
Synthetic peptide located within the following region: QVFKAKHRIDGKTYVIKRVKYNNEKAEREVKALAKLDHVNIVHYNGCWDG
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; TRAF6; TRAF5; TRAF2; EGFR; DHX9; STAU2; PRKRA; EIF2AK2; HECW2; TOP1; STAU1; DICER1; DHX30; EBNA1BP2; IGF2BP2; IGF2BP3; PABPC4; MOV10; ILF3; ILF2; HSP90AA1; EIF2A; NOC3L; GNL3; NOP2; HNRNPC; HIST1H1C; ELAVL1; NPM1; IL7R; gag; Jak2; TYK2; JAK1; EIF2S1;
Blocking Peptide:
For anti-EIF2AK2 (ARP36709_P050) antibody is Catalog # AAP36709 (Previous Catalog # AAPP08602)
Datasheets/Manuals:
Printable datasheet for anti-EIF2AK2 (ARP36709_P050) antibody
Sample Type Confirmation:

EIF2AK2 is strongly supported by BioGPS gene expression data to be expressed in HeLa

Product Reviews

Average Rating:
1 review
5 star
0
4 star
1
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

122/05/2019 23:19
  • Overall Experience:
  • Quality:
Human melanoma cell line in WB

Submitted by:
Dr. Praveen Bommareddy
Partners Healthcare

“My experience is it worked very well compared to another antibody I have which is twice expensive”

EIF2AK2

Sample type: Human melanoma cell line

Lane 1: 30ug human melanoma cell lysate
Lane 2: 30ug human melanoma cell lysate
Lane 3: 30ug human melanoma cell lysate (control; should have very low to no PKR)
Lane 4: 30ug human melanoma cell lysate
Lane 5: 30ug human melanoma cell lysate
Lane 6: 30ug human melanoma cell lysate
Lane 7: 30ug human melanoma cell lysate
Lane 8: 30ug human melanoma cell lysate

Primary antibody concentration: 0.5ug/ml

Secondary antibody and dilution: 1:2000

Protocol: Blocked with 2.5% Milk in TBST

0
0
Reply
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...