EIF2A Antibody - middlel region (ARP89639_P050)

Catalog No: ARP89639_P050

Host: Rabbit
Target Name: EIF2A
Sample Tissue: Mouse Spleen lysates
Antibody Dilution: 1ug/ml

Product Info

• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse EIF2A
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: PVTNSKLHEEEPPQNMKPHPGSDKPLSKTALKNQRKHEAKKAAKQEARSD
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-EIF2A (ARP89639_P050) antibody is Catalog # AAP89639

Target Info

• Gene Symbol: EIF2A
• Gene Full Name: eukaryotic translation initiation factor 2A
• Alias Symbols: D3Ertd194, D030048D22, D3Ertd194e
• NCBI Gene Id: 229317
• Protein Name: eukaryotic translation initiation factor 2A
• Description of Target: Functions in the early steps of protein synthesis of a small number of specific mRNAs. Acts by directing the binding of methionyl-tRNAi to 40S ribosomal subunits. In contrast to the eIF-2 complex, it binds methionyl-tRNAi to 40S subunits in a codon-dependent manner, whereas the eIF-2 complex binds methionyl-tRNAi to 40S subunits in a GTP-dependent manner.
• Uniprot ID: Q8BJW6
• Protein Accession #: NP_001005509.1
• Nucleotide Accession #: NM_001005509.2
• Protein Size (# AA): 581
• Molecular Weight: 63 kDa